Align Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate WP_038023703.1 HA49_RS16050 sugar ABC transporter ATP-binding protein
Query= TCDB::B8H229 (515 letters) >NCBI__GCF_000757425.2:WP_038023703.1 Length = 506 Score = 357 bits (915), Expect = e-103 Identities = 202/502 (40%), Positives = 304/502 (60%), Gaps = 12/502 (2%) Query: 3 LLDVSQVSKSFPGVRALDQVDLVVGVGEVHALLGENGAGKSTLIKILSAAHAADAGTVTF 62 LL + +SK FPGV+ALD V + GE+ ALLGENGAGKSTLIK+L+ + D G++ Sbjct: 9 LLTLKNISKRFPGVKALDDVSFSLRKGEIMALLGENGAGKSTLIKVLTGVYTRDQGSILL 68 Query: 63 AGQVLDPRDAPLRRQQLGIATIYQEFNLFPELSVAENMYLGREPRRLGLVDWSRLRADAQ 122 G+ ++PR + Q+ GI T+YQE NL P +SVA+N+++GREPRR GL+D L A Sbjct: 69 NGREINPRSTA-QAQESGIGTVYQEVNLLPNMSVADNLFMGREPRRFGLIDRRTLNRKAS 127 Query: 123 ALLNDLGLPLNPDAPVRGLTVAEQQMVEIAKAMTLNARLIIMDEPTAALSGREVDRLHAI 182 LL + G L+ AP+ +VA QQ++ I +A+ L+ +++I+DEPTA+L EV+ L + Sbjct: 128 ELLREYGFELDVTAPLGVFSVAMQQIIAICRAVDLSGQILILDEPTASLDTSEVEMLFTL 187 Query: 183 IAGLKARSVSVIYVSHRLGEVKAMCDRYTVMRDGRFVASGDVADVEVADMVRLMVGRHVE 242 + LKAR +S+I+V+H L +V + DR TV+R+GR+VA+ D A + ++++LM+GR + Sbjct: 188 MEKLKARGMSLIFVTHFLDQVYRITDRITVLRNGRYVATRDTATLPQLELIKLMLGRELL 247 Query: 243 FERRKRRRPPGAVVLKVEGVTPAAPRLSAPGYLRQVSFAARGGEIVGLAGLVGAGRTDLA 302 +R+ L E + + G + A R GEIVGLAGL+G+GRT+ A Sbjct: 248 STSLQRQ----GRTLHSENPVVSFSQYGRKGDIEPFDLAVRPGEIVGLAGLLGSGRTETA 303 Query: 303 RLIFGADPIAAGRVLVDDKPLRLRSPRDAIQAGIMLVPEDRKQQGCFLDHSIRRNLSLPS 362 ++FG G + +R+P A +AGI PEDRK G S+R N+ L Sbjct: 304 EVLFGIRRADQGTASIRGASQNIRTPARASRAGIGFCPEDRKTDGIIGAASVRENIIL-- 361 Query: 363 LKALSALGQW---VDERAERDLVETYRQKLRIKMADAETAIGKLSGGNQQKVLLGRAMAL 419 AL A W + + ++ E + L I+ D E + LSGGNQQKVLL R + Sbjct: 362 --ALQAQRGWLRPLSRHQQTEIAERLIKSLGIRTPDVEQPVELLSGGNQQKVLLSRWLVT 419 Query: 420 TPKVLIVDEPTRGIDIGAKAEVHQVLSDLADLGVAVVVISSELAEVMAVSDRIVVFREGV 479 P+ LI+DEPTRGIDIGA AE+ +++ L G+A++VISSEL E++ +DR+++ R+ Sbjct: 420 RPQFLILDEPTRGIDIGAHAEIIRLIESLCADGLALLVISSELEELVGYADRVIILRDHR 479 Query: 480 IVADLDAQTATEEGLMAYMATG 501 VA++ + + +M +A G Sbjct: 480 QVAEIPLERLSVGTIMTAIADG 501 Lambda K H 0.320 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 22 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 506 Length adjustment: 35 Effective length of query: 480 Effective length of database: 471 Effective search space: 226080 Effective search space used: 226080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory