Align glucose transporter, ATPase component (characterized)
to candidate WP_038023703.1 HA49_RS16050 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_000757425.2:WP_038023703.1 Length = 506 Score = 166 bits (421), Expect = 7e-46 Identities = 90/238 (37%), Positives = 143/238 (60%), Gaps = 2/238 (0%) Query: 13 TPLVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEI 72 T L+ +K+IS F G+KA+D VS L GE++ LLG NGAGKSTLIKVL+G Y D G I Sbjct: 7 TGLLTLKNISKRFPGVKALDDVSFSLRKGEIMALLGENGAGKSTLIKVLTGVYTRDQGSI 66 Query: 73 RVNGDKVEITNPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGLVDDSAMEAE 132 +NG ++ + A+ I T+YQ + L N+ A NLF+GRE FGL+D + + Sbjct: 67 LLNGREINPRSTAQAQESGIGTVYQEVNLLPNMSVADNLFMGRE-PRRFGLIDRRTLNRK 125 Query: 133 CRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAALGPHETQMV 192 +++ + P+ S +Q +AI RAV + +ILI+DEPTA+L E +M+ Sbjct: 126 ASELLREYGFELD-VTAPLGVFSVAMQQIIAICRAVDLSGQILILDEPTASLDTSEVEML 184 Query: 193 AELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLVGTVDIDDVTDDDLLSMII 250 L+++LKA+G+ + + H ++ V + DR +V++NG+ V T D + +L+ +++ Sbjct: 185 FTLMEKLKARGMSLIFVTHFLDQVYRITDRITVLRNGRYVATRDTATLPQLELIKLML 242 Score = 75.1 bits (183), Expect = 3e-18 Identities = 62/254 (24%), Positives = 114/254 (44%), Gaps = 11/254 (4%) Query: 7 LRAAGATPLVEMKDISISFGGIKA-VDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAY 65 L+ G T E +S S G K ++ + + PGE+VGL G G+G++ +VL G Sbjct: 251 LQRQGRTLHSENPVVSFSQYGRKGDIEPFDLAVRPGEIVGLAGLLGSGRTETAEVLFGIR 310 Query: 66 QMDAGEIRVNGDKVEITNPRDARSHNIETIYQTLALADNLDAAS---NLFLG----RELV 118 + D G + G I P A I + + AAS N+ L R + Sbjct: 311 RADQGTASIRGASQNIRTPARASRAGIGFCPEDRKTDGIIGAASVRENIILALQAQRGWL 370 Query: 119 TPFGLVDDSAMEAECRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMD 178 P + + K + P+ + +PV LSGG +Q V ++R + + LI+D Sbjct: 371 RPLSRHQQTEIAERLIKSLGIRTPDVE---QPVELLSGGNQQKVLLSRWLVTRPQFLILD 427 Query: 179 EPTAALGPHETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLVGTVDID 238 EPT + + LI+ L A G+ + +I ++ ++ DR ++++ + V + ++ Sbjct: 428 EPTRGIDIGAHAEIIRLIESLCADGLALLVISSELEELVGYADRVIILRDHRQVAEIPLE 487 Query: 239 DVTDDDLLSMIILG 252 ++ +++ I G Sbjct: 488 RLSVGTIMTAIADG 501 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 260 Length of database: 506 Length adjustment: 29 Effective length of query: 231 Effective length of database: 477 Effective search space: 110187 Effective search space used: 110187 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory