Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate WP_052384031.1 JH15_RS10185 ABC transporter permease
Query= CharProtDB::CH_014278 (328 letters) >NCBI__GCF_000759345.1:WP_052384031.1 Length = 331 Score = 183 bits (465), Expect = 4e-51 Identities = 100/294 (34%), Positives = 165/294 (56%), Gaps = 5/294 (1%) Query: 28 LVVFAVLFIACAIFVPNFATFINMKGLGLAISMSGMVACGMLFCLASGDFDLSVASVIAC 87 L+ +LF+ + F N+ + +S +G++A GM F + +G DLSV S++A Sbjct: 31 LLALLILFVLSSFASEYFLNARNITNVLRQVSYTGIIAIGMTFVIIAGGIDLSVGSMVAL 90 Query: 88 AGVTTAVVINLT----ESLWIGVAAGLLLGVLCGLVNGFVIAKLKINALITTLATMQIVR 143 GV V+N +++ +G+ A ++ G L GL NG ++ + ++ A + TLATM I R Sbjct: 91 VGVLLLYVVNAIADPIQAVLLGMLAAVVAGSLFGLFNGLLVTRGRMAAFVVTLATMSIFR 150 Query: 144 GLAYIISDGKAVGIEDESFFALGYANWFGLPAPIWLTVACLIIFGLLLNKTTFGRNTLAI 203 LA ++D V + F ++G FG+P P+W + +LL T FGR+ A+ Sbjct: 151 SLALYLTDAGEVTTRNPLFSSIGGGYLFGIPIPVWAFFGLALAAHVLLAHTPFGRHVCAV 210 Query: 204 GGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILASRMTSGQPM-TSIGYELIVISAC 262 G N + AR +G+ V R + F+++G+ ++ I+L+SR+ S P YEL I+A Sbjct: 211 GANSQVARYSGIRVERVVLSTFIIAGICVGLSAIMLSSRLNSVSPSDAGYFYELDAIAAV 270 Query: 263 VLGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISPFAQYVVRGLILLAAVI 316 V+GG +L GG G + V G LILG + N +NL +SP+ Q +V+G ++L AV+ Sbjct: 271 VIGGTALSGGRGSVWGTVIGALILGIINNMLNLTGVSPYLQGLVKGAVILLAVL 324 Lambda K H 0.327 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 331 Length adjustment: 28 Effective length of query: 300 Effective length of database: 303 Effective search space: 90900 Effective search space used: 90900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory