Align N-carbamoylputrescine amidohydrolase (EC 3.5.1.53) (characterized)
to candidate WP_043526756.1 JH15_RS02685 carbon-nitrogen hydrolase
Query= metacyc::MONOMER-17350 (290 letters) >NCBI__GCF_000759345.1:WP_043526756.1 Length = 298 Score = 323 bits (827), Expect = 4e-93 Identities = 159/295 (53%), Positives = 211/295 (71%), Gaps = 6/295 (2%) Query: 1 MKIALIQQKFHSNKEQTIKKTCEFIEEASKQGAELICLGELHQSEYFCQSENVDFFDYAN 60 + + L+QQ +KE+++ ++ I E + QGA+L+ L ELH + YFCQ E+ + FD A Sbjct: 5 LTVGLVQQAAWPDKERSLAESEAGIRELAAQGAQLVLLQELHATHYFCQYEDAELFDLAE 64 Query: 61 DYEKDV-KFWANIARKNQIVLITSLFEKRSAGLYHNTAVVFEKDGSIAGKYRKMHIPDDP 119 + + ++A++ IVL+ SLFE+R+AGLYHNTAVV+++D G YRKMHIPDDP Sbjct: 65 PLDGPTGQRLPHLAKELDIVLVGSLFERRAAGLYHNTAVVYDRDRGRVGHYRKMHIPDDP 124 Query: 120 CFYEKFYFTPGDL----GFEPINTSLGKLGVLICWDQWYPEAARIMALKGAEILIYPTAI 175 FYEKFYFTPG+ GFEPI+TS+G+LGVL+CWDQWYPEAAR+MAL GAE+L+YPTAI Sbjct: 125 GFYEKFYFTPGEADEARGFEPIDTSVGRLGVLVCWDQWYPEAARLMALAGAELLLYPTAI 184 Query: 176 GWFDKDKDEEKQRQLNAWLGVQKGHAIANGLYVVAINRVGFEKDVSGVEEGIRFWGNSFV 235 GW D EK RQ +AW VQ+ H +ANGL V+ NR+G E D SGV EGI FWG SF+ Sbjct: 185 GWHPPDDLPEKGRQKDAWTIVQRAHGVANGLPVLVANRIGHEPDHSGVTEGINFWGGSFI 244 Query: 236 FGPQGEELCLLDSQNECVKIIEIDKKRSENVRRWWPFLRDRRIEYFADLTKRFID 290 GPQGE L E + ++++D RSE+VRR WP+LRDRRI+ + DLT+R+ D Sbjct: 245 CGPQGEFLAHAGDGPERL-LVKLDMSRSEHVRRMWPYLRDRRIDGYGDLTRRYRD 298 Lambda K H 0.322 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 298 Length adjustment: 26 Effective length of query: 264 Effective length of database: 272 Effective search space: 71808 Effective search space used: 71808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory