Align AotJ aka PA0888, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate WP_052384206.1 JH15_RS16050 transporter substrate-binding domain-containing protein
Query= TCDB::O50181 (259 letters) >NCBI__GCF_000759345.1:WP_052384206.1 Length = 256 Score = 176 bits (446), Expect = 4e-49 Identities = 101/258 (39%), Positives = 151/258 (58%), Gaps = 5/258 (1%) Query: 3 KLALLGALALSVLSLP-TFAADKPVRIGIEAA-YPPFSLKTPDGQLAGFDVDIGNALCEE 60 K A+L + ++ L+ T AA P++IGI A YPPF+ K DG GF+V++G ALCE+ Sbjct: 2 KQAILKTVGMTALAFTFTTAAADPLKIGISAEPYPPFTFKGSDGSWTGFEVELGQALCEK 61 Query: 61 MKVQCKWVEQEFDGLIPALKVRKIDAILSSMTITDERKRSVDFTNKYYNTPARFVMKEGA 120 M+ +C+ + G+ AL KID I++S++IT++RK +DFT+ YY TP+ +V + Sbjct: 62 MQAECEITPTGWSGIFAALDSGKIDMIMNSLSITEQRKEVIDFTDPYYFTPSAYVAAKSD 121 Query: 121 SLNDPKADLKGKKAGVLRGSTADRYASAELTPAGVEVVRYNSQQEANMDLVAGRLDAVVA 180 S + P+ L GK GV G+T YA EL GVE+ Y+ Q++AN DL AGR+DA++A Sbjct: 122 SFDIPEG-LDGKLLGVQGGTTNATYARRELRDTGVEIKIYDQQEQANRDLFAGRVDAILA 180 Query: 181 DSVNLEDGFLKTDAGKGYAFVGPQLTDAKYFGEGVGIAVRKGDSELAGKFNAAIDALRAN 240 D V + + ++ D Y A FGEGVGI +R+ D +L + N AI + Sbjct: 181 DKVAMTE-LVERDEASEYEIRATAPRHAA-FGEGVGIGLRQSDDDLRQRLNQAISEALED 238 Query: 241 GKYKQIQDKYFSFDVYGS 258 G + +YF D+ GS Sbjct: 239 GTCTDLSQEYFGTDICGS 256 Lambda K H 0.316 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 256 Length adjustment: 24 Effective length of query: 235 Effective length of database: 232 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory