Align ABC transporter for L-Arginine, permease component 2 (characterized)
to candidate WP_043529792.1 JH15_RS09830 ABC transporter permease
Query= reanno::BFirm:BPHYT_RS07675 (229 letters) >NCBI__GCF_000759345.1:WP_043529792.1 Length = 234 Score = 239 bits (611), Expect = 3e-68 Identities = 130/227 (57%), Positives = 162/227 (71%), Gaps = 7/227 (3%) Query: 3 LYGFGPVLLAGTIQTIELSVLSLAAAVLLGLAGAAAKLSFNRPLRAIATGYTTLIRSVPD 62 L+G+GP LL G + TIEL+VLSL AV+LGL A+AK+S N L +AT YTT+IR VPD Sbjct: 4 LHGYGPRLLEGALVTIELAVLSLVVAVVLGLLTASAKMSRNWMLHKVATLYTTVIRGVPD 63 Query: 63 LVLMLLLFYSIQIAVNNLTDALNLPQFDID------PFVAGVLTLGFIYGAYFTETFRGA 116 LVLM+L+F+ QI +N TD L +FDID FVAGV+T+G I+GAY ETFRGA Sbjct: 64 LVLMMLMFFGGQIGINMFTDML-YDRFDIDIFINVNEFVAGVITIGLIFGAYMGETFRGA 122 Query: 117 FLAVPRGQLEAGSAYGMSGARVFTRILFPQMMRFALPGIGNNWQVLVKATALVSIIGLAD 176 F+AV GQ+EAG AYGMS VF RI FP MMR ALPG+ NNW VL+K TALVS+IGL+D Sbjct: 123 FMAVDNGQIEAGRAYGMSHWLVFRRIRFPLMMRHALPGLSNNWMVLLKTTALVSVIGLSD 182 Query: 177 VVKAAQDAGKSTFNMFFFILVAALIYLAITTASNLVLIWLEKRYSIG 223 +V+ A +A K+T F F+++ ALIYL I T S L+KRY +G Sbjct: 183 MVRVASEASKATREPFTFMIIVALIYLLIATFSEWGFARLQKRYDVG 229 Lambda K H 0.329 0.142 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 234 Length adjustment: 23 Effective length of query: 206 Effective length of database: 211 Effective search space: 43466 Effective search space used: 43466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory