Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate WP_043532177.1 JH15_RS16055 ABC transporter permease subunit
Query= reanno::pseudo3_N2E3:AO353_03050 (229 letters) >NCBI__GCF_000759345.1:WP_043532177.1 Length = 234 Score = 191 bits (486), Expect = 8e-54 Identities = 90/205 (43%), Positives = 138/205 (67%) Query: 2 LKGYGAVILDGAWLTLQLALSSMALAIVLGLIGVALRLSPIRWLARLGDLYSTVIRGIPD 61 L + IL GA +T+++AL + + + LGL+G A RLSP R + L YST++R +P+ Sbjct: 9 LMDWAGPILQGALVTIEIALLAYVIGLGLGLVGAAARLSPYRPIQALAAFYSTLVRAVPE 68 Query: 62 LVLILLIFYGGQDLLNRVAPLLGYDDYIDLNPLVAGIGTLGFIFGAYLSETFRGAFMAIP 121 L+LI+L++Y G LN V LG+ ++++ ++ +G L F+ GAY++E FRGA +AIP Sbjct: 69 LLLIILLYYAGTQALNMVLGALGWQSQLEISGFISAVGVLAFVQGAYMTEVFRGAILAIP 128 Query: 122 KGQAEAGAAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKA 181 +GQ EA AYG S + F R+++P M+ A+PG +N WL+L K TALISV+G +++ F A Sbjct: 129 RGQLEAADAYGFSRWARFHRIVIPAMLPNALPGMSNLWLILVKDTALISVIGFEELFFTA 188 Query: 182 KQAADATREPFTFFLAVAAMYLVIT 206 +QAA +TR F F+ A+YLV+T Sbjct: 189 QQAAASTRSYFLFYAVAGALYLVMT 213 Lambda K H 0.329 0.144 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 234 Length adjustment: 23 Effective length of query: 206 Effective length of database: 211 Effective search space: 43466 Effective search space used: 43466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory