Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_043527315.1 JH15_RS04225 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_000759345.1:WP_043527315.1 Length = 432 Score = 258 bits (658), Expect = 3e-73 Identities = 150/408 (36%), Positives = 227/408 (55%), Gaps = 20/408 (4%) Query: 41 ERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFYENAI 100 +R E ++D DGN DFA G+GV+N+GH HP+VVEA+K Q +K H T YE + Sbjct: 27 DRAENALIWDADGNRLIDFAGGIGVLNIGHRHPKVVEAVKAQLDKVMHTCQTVMPYEGYV 86 Query: 101 ILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQAVLS 160 +AEKL ++ P KV+ NSGAEA E A+K+ + TG+ + F +HGRT ++ Sbjct: 87 KVAEKLSQITPVRGHAKVMLANSGAEALENAVKVARAATGKNNVICFDGGYHGRTFMTMA 146 Query: 161 LTASKWVQQDGFFPTMPG-VTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVFRHV 219 + K F +MPG V PYP PY G E + L ++ + Sbjct: 147 MN-GKVAPYATDFGSMPGNVFRAPYPVPYH------GVSEDEALRG-----LKMALKTDA 194 Query: 220 PPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFWAIE 279 P + AI EP+ GEGG+ P F KA++ DE+GILL DEVQ G GRTGK +AIE Sbjct: 195 NPKDTAAIVLEPVLGEGGFYAAPASFLKAIRDICDEHGILLIIDEVQSGFGRTGKMFAIE 254 Query: 280 HFGVEPDLIQFGKAIGGGLPLAGVIHRADITFDKPGRHAT--TFGGNPVAIAAGIEVVEI 337 H GVEPD+I K++ G+P++ V+ D D G ++ T+ G+PV+ AA + V+E+ Sbjct: 255 HSGVEPDIICMAKSMADGMPISAVV-GTDKVMDASGGNSLGGTYTGSPVSCAATLAVLEV 313 Query: 338 VKE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKYPELRD 395 +E +L Q +GD L K ++++ ++ + + R LG A ++V K +L Sbjct: 314 FEEEKILEKSQALGDKLAKRFSQWEQDFDCVDNGRNLGAMAAFDLVSDKAQHTPDADLAG 373 Query: 396 RIVKESAKRGLVLLGCG--DNSIRFIPPLIVTKEEIDVAMEIFEEALK 441 + K + ++GLVLL CG N+IRF+ P+ + + ++ + + E ALK Sbjct: 374 ALCKRAREKGLVLLSCGLYGNTIRFLMPVTIEDDILEEGLGVVESALK 421 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 432 Length adjustment: 32 Effective length of query: 413 Effective length of database: 400 Effective search space: 165200 Effective search space used: 165200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory