Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_043531904.1 JH15_RS15200 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000759345.1:WP_043531904.1 Length = 246 Score = 235 bits (599), Expect = 8e-67 Identities = 120/247 (48%), Positives = 170/247 (68%), Gaps = 2/247 (0%) Query: 17 VSDEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQS 76 ++D++ + + ++ K Y VL+ I+ ++RGE V+ GPSGSGKST++RCIN+L + Sbjct: 1 MADDLILDVQEVKKAYDGVEVLKGISFGLYRGETKVLIGPSGSGKSTLLRCINQLTVPDA 60 Query: 77 GKIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEE 136 G+I ++G E+ NID +R+ +G VFQ FNLF HLT+L+N+ + I V + K +A + Sbjct: 61 GRIYLNGKEVLDS--NIDTMRARMGFVFQDFNLFSHLTVLDNVRICQIKVNGINKDDATQ 118 Query: 137 TAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEV 196 A LE+V + E+A YP +LSGGQQQRV+IAR+L M P ++LFDEPTSALDPE+ EV Sbjct: 119 RAHRELERVGLSERANAYPAELSGGQQQRVSIARALAMDPDVLLFDEPTSALDPELTGEV 178 Query: 197 LDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQF 256 + M QLA EGMTM+ VTHEM FA+ A+ +IFM +G IVEQ P + F S+RT+ F Sbjct: 179 VRVMQQLAVEGMTMVVVTHEMSFARQAADEIIFMENGHIVEQGTPAELFDASASDRTRAF 238 Query: 257 LSQILGH 263 L+ I H Sbjct: 239 LNIIKEH 245 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 246 Length adjustment: 24 Effective length of query: 239 Effective length of database: 222 Effective search space: 53058 Effective search space used: 53058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory