Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate WP_081948993.1 JH15_RS11225 amino acid ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >NCBI__GCF_000759345.1:WP_081948993.1 Length = 272 Score = 215 bits (548), Expect = 6e-61 Identities = 111/243 (45%), Positives = 158/243 (65%), Gaps = 3/243 (1%) Query: 1 MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITV 60 MI L+ + K +G VL E+++GE++VV GPSG+GKSTL++ +N LE G + + Sbjct: 1 MIELEGLIKRFGDTTVLDGIDLEIQEGEIIVVIGPSGTGKSTLLRCMNFLERPDAGRLRI 60 Query: 61 DGI---VVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKA 117 + V +K ++ LR R VFQ++ LF + + +EN+ + V + +A A +A Sbjct: 61 GDLDLDVTRARKAEILALRRRTAFVFQNYALFANKTALENIAEGLIVVNRWPRAKAHSRA 120 Query: 118 LKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLD 177 ++LER+GL+ AN +PA LSGGQQQR+ I RA+ +LFDEPTS+LDPE + EVL Sbjct: 121 HEILERIGLAEKANAYPASLSGGQQQRIGIGRAMAAQADVILFDEPTSSLDPEWVEEVLG 180 Query: 178 VMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLA 237 +M +LA E TM+VVTHEMGFAR VA+RVIFMD G+IVE F P+ +R +DFL Sbjct: 181 LMKQLARERQTMLVVTHEMGFARDVADRVIFMDGGRIVEQDVPSRLFTQPRDERTRDFLR 240 Query: 238 KIL 240 K+L Sbjct: 241 KVL 243 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 272 Length adjustment: 24 Effective length of query: 217 Effective length of database: 248 Effective search space: 53816 Effective search space used: 53816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory