Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_043531246.1 JH15_RS13610 amino acid ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000759345.1:WP_043531246.1 Length = 257 Score = 239 bits (609), Expect = 5e-68 Identities = 125/246 (50%), Positives = 175/246 (71%), Gaps = 5/246 (2%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 ++ + VNK++G HVLK+I+L + GE +VIIG SGSGKST IRC+NGLEE G + V Sbjct: 13 IVRMDKVNKHFGDLHVLKDIDLEIAPGEVVVIIGASGSGKSTLIRCVNGLEEFQYGHIEV 72 Query: 61 --NNLVLNHKNK--IEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETA 116 N L+ N K+ ++ R MVFQ FNL+PH++VL N+TLAP+K++ +++A A Sbjct: 73 DGNELLPNGKSAKALQTIRTEVGMVFQQFNLFPHLSVLDNVTLAPIKVRGTPRQQAVANA 132 Query: 117 FKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLD 176 + L+ VG+ D+A+ P LSGGQQQRVA+AR+L + +LFDEPTSALDPE I EVLD Sbjct: 133 RRLLERVGIADQADKSPTQLSGGQQQRVALARALTMEPRLMLFDEPTSALDPEMIGEVLD 192 Query: 177 VMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFL 236 M+E++ + TM++VTHEMGFA+EVADR+I++ G IVE+ P F NP+ ER + FL Sbjct: 193 AMRELA-RDGMTMMIVTHEMGFAREVADRVIYIHGGQIVEQGPPGVVFDNPQHERTQSFL 251 Query: 237 GKILKN 242 ++LK+ Sbjct: 252 SRVLKH 257 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 257 Length adjustment: 24 Effective length of query: 218 Effective length of database: 233 Effective search space: 50794 Effective search space used: 50794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory