Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_081948993.1 JH15_RS11225 amino acid ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000759345.1:WP_081948993.1 Length = 272 Score = 224 bits (570), Expect = 2e-63 Identities = 115/246 (46%), Positives = 171/246 (69%), Gaps = 5/246 (2%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 MIEL+ + K +G VL I+L ++EGE +V+IGPSG+GKST +RCMN LE +G + + Sbjct: 1 MIELEGLIKRFGDTTVLDGIDLEIQEGEIIVVIGPSGTGKSTLLRCMNFLERPDAGRLRI 60 Query: 61 NNLVLN----HKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETA 116 +L L+ K +I R+ A VFQ++ L+ + T L+N+ + + + + +A A Sbjct: 61 GDLDLDVTRARKAEILALRRRTAFVFQNYALFANKTALENIAEGLIVVNRWPRAKAHSRA 120 Query: 117 FKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLD 176 + L+ +GL +KAN YPA+LSGGQQQR+ I R++ + ILFDEPTS+LDPE ++EVL Sbjct: 121 HEILERIGLAEKANAYPASLSGGQQQRIGIGRAMAAQADVILFDEPTSSLDPEWVEEVLG 180 Query: 177 VMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFL 236 +MK+++ + TM+VVTHEMGFA++VADR+IFM+ G IVE+++PS F+ P+ ER R FL Sbjct: 181 LMKQLARE-RQTMLVVTHEMGFARDVADRVIFMDGGRIVEQDVPSRLFTQPRDERTRDFL 239 Query: 237 GKILKN 242 K+L N Sbjct: 240 RKVLAN 245 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 272 Length adjustment: 24 Effective length of query: 218 Effective length of database: 248 Effective search space: 54064 Effective search space used: 54064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory