Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_043531902.1 JH15_RS15195 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03045 (232 letters) >NCBI__GCF_000759345.1:WP_043531902.1 Length = 222 Score = 131 bits (329), Expect = 1e-35 Identities = 74/219 (33%), Positives = 121/219 (55%), Gaps = 11/219 (5%) Query: 4 DYNVIWEALPLYFGGLVTTLKLLALSLLFGLLAALPLGLMRVSKQPIVNMSAWLYTYVIR 63 ++ + W LP G+ TL L +++ G L L RV + + Y + R Sbjct: 6 EFGIEW--LPRLLQGVPVTLLLWIIAITLGFFLGLMLCWARVYGNRLFYWISTAYVELFR 63 Query: 64 GTPMLVQLFLIYYGLAQFEAVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRAT 123 GTPMLVQ+F IY GL V ++F A +A +N++AY AE GS+ + Sbjct: 64 GTPMLVQMFFIYLGLPHVGIVFDAFT---------AAVIAITLNSAAYQAEYFRGSVLSV 114 Query: 124 PNGEIEAAKAMGMSRFKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGA 183 P G++ AA+A GMS+++ + I+LP ALRR +PQ+SNE I+ L+ TS+A + +++IT Sbjct: 115 PKGQLVAARACGMSQWQAIRHIMLPQALRRVIPQWSNEAIIELKFTSIAYTIGVVEITAI 174 Query: 184 ARTVNAQYYLPFEAYITAGVFYLCMTFILVRLFKMAEHR 222 A + ++ + F+ ++ AG+ YL +T + L + E R Sbjct: 175 ASDIGSRTFDFFQVFLWAGIIYLVLTSTVASLLGLLERR 213 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 222 Length adjustment: 22 Effective length of query: 210 Effective length of database: 200 Effective search space: 42000 Effective search space used: 42000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory