Align Carbon-nitrogen hydrolase family protein; EC 3.5.-.- (characterized, see rationale)
to candidate WP_043526756.1 JH15_RS02685 carbon-nitrogen hydrolase
Query= uniprot:Q5NHL7_FRATT (286 letters) >NCBI__GCF_000759345.1:WP_043526756.1 Length = 298 Score = 195 bits (496), Expect = 9e-55 Identities = 118/294 (40%), Positives = 172/294 (58%), Gaps = 13/294 (4%) Query: 4 IKVAVVQLSFNDNEAENLAKLESKIIQAAKNGAKIILTPELPSYLYFCKKQNSKYFDLAK 63 + V +VQ + ++ +LA+ E+ I + A GA+++L EL + YFC+ ++++ FDLA+ Sbjct: 5 LTVGLVQQAAWPDKERSLAESEAGIRELAAQGAQLVLLQELHATHYFCQYEDAELFDLAE 64 Query: 64 TIDESPIVKLYKLLAHKYNIVLPASFFERDGNACYNSIAMI-DADGSIMGVYRKAHIPDG 122 +D P + LA + +IVL S FER Y++ A++ D D +G YRK HIPD Sbjct: 65 PLD-GPTGQRLPHLAKELDIVLVGSLFERRAAGLYHNTAVVYDRDRGRVGHYRKMHIPDD 123 Query: 123 IGYQEKYYFSPGSA----GFKVWDTKYAKVGVGICWDQWFPEAARVMALKGAEILLYPTA 178 G+ EK+YF+PG A GF+ DT ++GV +CWDQW+PEAAR+MAL GAE+LLYPTA Sbjct: 124 PGFYEKFYFTPGEADEARGFEPIDTSVGRLGVLVCWDQWYPEAARLMALAGAELLLYPTA 183 Query: 179 IGSEP--HLPDYD-SKDHWQRVMQGHAAANMLPVLASNRYATEA-NDDIT--ATYYGSSF 232 IG P LP+ KD W V + H AN LPVL +NR E + +T ++G SF Sbjct: 184 IGWHPPDDLPEKGRQKDAWTIVQRAHGVANGLPVLVANRIGHEPDHSGVTEGINFWGGSF 243 Query: 233 ITDHTGDKIAEADRSGDDILYATFDFAELQQQRFYWGLFRDRRPELYDEIVRKY 286 I G+ +A A G + L D + + R W RDRR + Y ++ R+Y Sbjct: 244 ICGPQGEFLAHAG-DGPERLLVKLDMSRSEHVRRMWPYLRDRRIDGYGDLTRRY 296 Lambda K H 0.320 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 298 Length adjustment: 26 Effective length of query: 260 Effective length of database: 272 Effective search space: 70720 Effective search space used: 70720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory