Align 2-deoxy-3-keto-D-ribonate cleavage enzyme (characterized)
to candidate WP_043532163.1 JH15_RS16010 3-keto-5-aminohexanoate cleavage protein
Query= reanno::Burk376:H281DRAFT_00641 (312 letters) >NCBI__GCF_000759345.1:WP_043532163.1 Length = 292 Score = 187 bits (476), Expect = 2e-52 Identities = 123/319 (38%), Positives = 166/319 (52%), Gaps = 48/319 (15%) Query: 5 SRKVIISCAITGATHVPSMSEFLPITPEQIRDQAIEAAQAGAAIIHLHARDPVDGRPTPS 64 +R VI++CAITGA + LP+TP QI D AIEAA+AGA+I+HLH RDP G + S Sbjct: 2 NRDVILTCAITGAGDTANKHPELPVTPRQIADSAIEAARAGASIVHLHVRDPETGGISHS 61 Query: 65 PEIFKAFVPAIAEA-TDAVINITTG-----------------GSTRMTLEERLAYPRLAR 106 F+ V I EA D VIN+T G G+ T ER A Sbjct: 62 TAHFREAVSRIREADIDVVINLTAGGGGDWVPHPDDPTRGGEGTDMQTPAERHAPIGELL 121 Query: 107 PEMCSLNMGSMNFSIHPVAAKISSWRYGWEKDYIEGMEDMIFRNTFRDIRNILLELGESG 166 PE+C+L+ GS+NF D ++ NT +R + E+G Sbjct: 122 PELCTLDCGSLNFG------------------------DTVYLNTADWLREHARLVKEAG 157 Query: 167 TRFEFECYDVGHLYNLAHFVDQGLVKPPFFIQSVFGILGGLGADPENMLLMRSTADRLFG 226 + E EC+D+GH++ +++GL++ Q GI G AD E ML MR+ Sbjct: 158 VKPELECFDLGHVWFARQLIEEGLIEGDPLFQLCLGIPWGAEADTETMLAMRNKLP---- 213 Query: 227 RENYHFSVLGAGRHQMPLVTMSAIMGGNVRVGLEDSVYLAKGVKAETNAQQVRKIRRILE 286 N H+S G GR +MP+V S ++GG+VRVGLED++YL+KGV A TNAQ V K I E Sbjct: 214 -ANAHWSAFGIGRTEMPMVAQSILLGGHVRVGLEDNLYLSKGVFA-TNAQLVEKAANIAE 271 Query: 287 ELSLEIATPADARKMLGLK 305 L I TPA R+ L L+ Sbjct: 272 NLGSRILTPAQTRQKLDLR 290 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 292 Length adjustment: 27 Effective length of query: 285 Effective length of database: 265 Effective search space: 75525 Effective search space used: 75525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory