Align Monosaccharide-transporting ATPase; EC 3.6.3.17 (characterized, see rationale)
to candidate WP_052384031.1 JH15_RS10185 ABC transporter permease
Query= uniprot:B2SYR4 (338 letters) >NCBI__GCF_000759345.1:WP_052384031.1 Length = 331 Score = 193 bits (491), Expect = 4e-54 Identities = 104/295 (35%), Positives = 169/295 (57%), Gaps = 5/295 (1%) Query: 39 IVIFVVMFATMSLTVDHFFSIENMLGLALSISQIGMVSCTMMFCLASRDFDLSVGSTVAF 98 ++ +++F S ++F + N+ + +S G+++ M F + + DLSVGS VA Sbjct: 31 LLALLILFVLSSFASEYFLNARNITNVLRQVSYTGIIAIGMTFVIIAGGIDLSVGSMVAL 90 Query: 99 AGVLCAMVLNATGNTFIAIV----AAVAAGGVIGFVNGAVIAYLRINALITTLATMEIVR 154 GVL V+NA + A++ AAV AG + G NG ++ R+ A + TLATM I R Sbjct: 91 VGVLLLYVVNAIADPIQAVLLGMLAAVVAGSLFGLFNGLLVTRGRMAAFVVTLATMSIFR 150 Query: 155 GLGFIVSHGQAVGVSSDTFIALGGLSFFGVSLPIWVTLLCFIVFGVMLNQTVYGRNTLAI 214 L ++ V + F ++GG FG+ +P+W + V+L T +GR+ A+ Sbjct: 151 SLALYLTDAGEVTTRNPLFSSIGGGYLFGIPIPVWAFFGLALAAHVLLAHTPFGRHVCAV 210 Query: 215 GGNPEASRLAGINVERTRVYIFLIQGAVTALAGVILASRITSGQP-NAAQGFELNVISAC 273 G N + +R +GI VER + F+I G L+ ++L+SR+ S P +A +EL+ I+A Sbjct: 211 GANSQVARYSGIRVERVVLSTFIIAGICVGLSAIMLSSRLNSVSPSDAGYFYELDAIAAV 270 Query: 274 VLGGVSLLGGRATISGVVIGVLIMGTVENVMNLMNIDAFYQYLVRGAILLAAVLL 328 V+GG +L GGR ++ G VIG LI+G + N++NL + + Q LV+GA++L AVLL Sbjct: 271 VIGGTALSGGRGSVWGTVIGALILGIINNMLNLTGVSPYLQGLVKGAVILLAVLL 325 Lambda K H 0.326 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 331 Length adjustment: 28 Effective length of query: 310 Effective length of database: 303 Effective search space: 93930 Effective search space used: 93930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory