Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate WP_043531902.1 JH15_RS15195 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >NCBI__GCF_000759345.1:WP_043531902.1 Length = 222 Score = 125 bits (313), Expect = 8e-34 Identities = 71/211 (33%), Positives = 114/211 (54%), Gaps = 2/211 (0%) Query: 5 LNFAAVWRDFDTLLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVYVTVI 64 + F W LL G+ + L L +++I +G +GL++ +A + +R +++ YV + Sbjct: 5 IEFGIEW--LPRLLQGVPVTLLLWIIAITLGFFLGLMLCWARVYGNRLFYWISTAYVELF 62 Query: 65 RNTPILVLILLIYFALPSLGIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGLREAG 124 R TP+LV + IY LP +GI D + +I ++L + AY E FRG +LS+PKG A Sbjct: 63 RGTPMLVQMFFIYLGLPHVGIVFDAFTAAVIAITLNSAAYQAEYFRGSVLSVPKGQLVAA 122 Query: 125 LAIGLGEWQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVES 184 A G+ +WQ ++ +P LR V+P SN I K TS+A I V E+T A I + Sbjct: 123 RACGMSQWQAIRHIMLPQALRRVIPQWSNEAIIELKFTSIAYTIGVVEITAIASDIGSRT 182 Query: 185 YRVIETWLVTTALYVAACYLIAMLLRYLEQR 215 + + +L +Y+ +A LL LE+R Sbjct: 183 FDFFQVFLWAGIIYLVLTSTVASLLGLLERR 213 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 222 Length adjustment: 22 Effective length of query: 198 Effective length of database: 200 Effective search space: 39600 Effective search space used: 39600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory