Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_043532174.1 JH15_RS16045 ATP-binding cassette domain-containing protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >NCBI__GCF_000759345.1:WP_043532174.1 Length = 262 Score = 242 bits (617), Expect = 7e-69 Identities = 131/257 (50%), Positives = 178/257 (69%), Gaps = 1/257 (0%) Query: 5 STPSNTQPLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEE 64 +T N +D R L+K YG + VL V LS+ +VV++IGSSGSGK+TLLRC+N+LE Sbjct: 4 TTRQNKTLAVDARHLQKHYGEVPVLHDVSLSVTDRHVVSIIGSSGSGKSTLLRCMNLLEI 63 Query: 65 FQGGQIVLDGESIGYD-DIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLG 123 G++ + E+I + + G V + + + R+ M FQQFNL+PHL+ L NV Sbjct: 64 PDRGELTIANEAIRFQRNAQGDNVGIDRRQVHKLRSQVSMVFQQFNLWPHLSVLGNVIEA 123 Query: 124 LLKVKKLPKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFD 183 L+V L + EA+ E +L +VGL ++R+ FP LSGGQQQRVAIARA+AM P ++LFD Sbjct: 124 PLRVHGLSRREAIERGEHYLAKVGLADKRNAFPSFLSGGQQQRVAIARALAMEPRVLLFD 183 Query: 184 EVTSALDPELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPK 243 E TSALDPELV EVL VI GLA +G TMLLVTHEM FA EVS++IVF++QG +EE G P+ Sbjct: 184 EPTSALDPELVNEVLGVIGGLAGEGRTMLLVTHEMSFAREVSNEIVFLHQGHVEEAGSPQ 243 Query: 244 ELFERPQSPRLAEFLKN 260 ++FE+ +S R +FL + Sbjct: 244 QVFEQARSDRCRQFLSS 260 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 262 Length adjustment: 25 Effective length of query: 238 Effective length of database: 237 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory