Align ABC transporter for Glycerol, permease component 1 (characterized)
to candidate WP_043530253.1 JH15_RS11300 sugar ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_793 (298 letters) >NCBI__GCF_000759345.1:WP_043530253.1 Length = 294 Score = 383 bits (983), Expect = e-111 Identities = 183/273 (67%), Positives = 224/273 (82%) Query: 9 NQKAWFLILPVIICVAFSAILPLMTVVNYSVQDIISPERRVFVGTEWFAAVMRDEELHAA 68 N AW+LILP+++ VAFSAI+PLMTVVNYSVQD+ P R F GTEWF ++ D L AA Sbjct: 6 NNHAWWLILPMLLLVAFSAIIPLMTVVNYSVQDVFDPYTRFFTGTEWFQVMLNDPALQAA 65 Query: 69 LWRQLTFSLAVLAVEIPLGILLALSMPAQGWKSSAVLVVVALSLLIPWNVVGTIWQIYGR 128 L RQ FSL +LA+E+PLGI +AL MP QGW++SAVL++V L LLIPWNVVG+IWQI+ R Sbjct: 66 LLRQFAFSLTILAIEVPLGIGIALIMPKQGWQASAVLILVTLPLLIPWNVVGSIWQIFTR 125 Query: 129 ADIGLMGRMLQEMGIEYSYTGNATQAWLTVLLMDVWHWTPLVALLAFAGLRSIPDAYYQA 188 DIGLMG L+E+G Y+ T + AW T++LMDVWHWTPL+ALL ++GLR+IP+AYYQA Sbjct: 126 GDIGLMGWGLRELGYGYNITRSPADAWATIVLMDVWHWTPLIALLCYSGLRAIPEAYYQA 185 Query: 189 ARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGNATTFLSQY 248 ARID ASK+AVFR+IQLPK+ VL+I +LLRFM SFMIY EPFVLTGGGPG++TTFLSQ Sbjct: 186 ARIDRASKWAVFRFIQLPKLTNVLVIGILLRFMHSFMIYAEPFVLTGGGPGSSTTFLSQS 245 Query: 249 LTTKAVGQFDLGPAAAFSLIYFFIILLLCFILY 281 LTT A+GQ DLGP+AAFSLIYF IILL+ ++ Y Sbjct: 246 LTTMAIGQQDLGPSAAFSLIYFLIILLVSWVFY 278 Lambda K H 0.328 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 294 Length adjustment: 26 Effective length of query: 272 Effective length of database: 268 Effective search space: 72896 Effective search space used: 72896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory