Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_043531902.1 JH15_RS15195 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_000759345.1:WP_043531902.1 Length = 222 Score = 133 bits (335), Expect = 2e-36 Identities = 76/218 (34%), Positives = 126/218 (57%), Gaps = 3/218 (1%) Query: 3 LDFSPVWAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAA 62 ++F W +P+LL G VT+ + ++ LG +GL++ R+ R + Y + TAYV Sbjct: 5 IEFGIEW--LPRLLQGVPVTLLLWIIAITLGFFLGLMLCWARVYGNR-LFYWISTAYVEL 61 Query: 63 IRGTPLLVQLFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEA 122 RGTP+LVQ+F ++ GLP GI+ AF VI + + S AY +E RG++ S+ KGQ+ A Sbjct: 62 FRGTPMLVQMFFIYLGLPHVGIVFDAFTAAVIAITLNSAAYQAEYFRGSVLSVPKGQLVA 121 Query: 123 ARSIGMSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISV 182 AR+ GMS A+R ++LPQA+ R+IP NE I +K +++ + + ++ I S Sbjct: 122 ARACGMSQWQAIRHIMLPQALRRVIPQWSNEAIIELKFTSIAYTIGVVEITAIASDIGSR 181 Query: 183 SYRSLEVYLAIAVVYFILTGATTLVLRRIELRLRAGGM 220 ++ +V+L ++Y +LT +L +E R G+ Sbjct: 182 TFDFFQVFLWAGIIYLVLTSTVASLLGLLERRTYVPGV 219 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 222 Length adjustment: 22 Effective length of query: 200 Effective length of database: 200 Effective search space: 40000 Effective search space used: 40000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory