Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_052384206.1 JH15_RS16050 transporter substrate-binding domain-containing protein
Query= TCDB::Q9HU31 (250 letters) >NCBI__GCF_000759345.1:WP_052384206.1 Length = 256 Score = 173 bits (438), Expect = 3e-48 Identities = 94/237 (39%), Positives = 139/237 (58%), Gaps = 7/237 (2%) Query: 15 LAFALDASAADKLRIGTEGA-YPPFNGIDASGQAVGFDLDIGKALCAKMKTECEVVTSDW 73 LAF +AAD L+IG YPPF + G GF++++G+ALC KM+ ECE+ + W Sbjct: 14 LAFTFTTAAADPLKIGISAEPYPPFTFKGSDGSWTGFEVELGQALCEKMQAECEITPTGW 73 Query: 74 DGIIPALNAKKFDFIVASMSITDERKQAVDFTDPYYTNKLQFVAPKSVDFKTDKDSLKGK 133 GI AL++ K D I+ S+SIT++RK+ +DFTDPYY +VA KS F + L GK Sbjct: 74 SGIFAALDSGKIDMIMNSLSITEQRKEVIDFTDPYYFTPSAYVAAKSDSFDI-PEGLDGK 132 Query: 134 VIGAQRATIAGTWLEDNMADV-VTIKLYDTQENAYLDLSSGRLDGVLADKFVQYDWLKSD 192 ++G Q T T+ + D V IK+YD QE A DL +GR+D +LADK + ++ D Sbjct: 133 LLGVQGGTTNATYARRELRDTGVEIKIYDQQEQANRDLFAGRVDAILADKVAMTELVERD 192 Query: 193 AGKEFEFKG---EPVFDNDKIGIAVRKG-DPLREKLNAALKEIVADGTYKKINDKYF 245 E+E + + +GI +R+ D LR++LN A+ E + DGT ++ +YF Sbjct: 193 EASEYEIRATAPRHAAFGEGVGIGLRQSDDDLRQRLNQAISEALEDGTCTDLSQEYF 249 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 256 Length adjustment: 24 Effective length of query: 226 Effective length of database: 232 Effective search space: 52432 Effective search space used: 52432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory