Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_043532367.1 JH15_RS16675 urea ABC transporter ATP-binding protein UrtD
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000759345.1:WP_043532367.1 Length = 277 Score = 134 bits (336), Expect = 3e-36 Identities = 79/252 (31%), Positives = 139/252 (55%), Gaps = 10/252 (3%) Query: 10 PLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVI 69 P+L + SF G KA+ + + + G + +IGPNGAGKTT+ ++++ RPD G V Sbjct: 30 PILYMEDVTVSFDGFKAINDLNLTIDDGELRCIIGPNGAGKTTMMDIITGKTRPDTGSVW 89 Query: 70 FDG-EPIQQLQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQPQV 128 F + L +IA+ G+ R FQ L+V EN+ LA ++ P + Sbjct: 90 FGSRHNLLTLSEPEIARLGIGRKFQKPTVFEALTVFENLELAMATDK-------RVLPTL 142 Query: 129 VVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAA 188 + + ++++ +L +GL + + AG LS GQ++ LE+G LM P+L+L+DEP A Sbjct: 143 MARMNGDIRDRIDEVLGMIGLEAQYRQPAGILSHGQKQWLEIGMLLMQRPRLLLVDEPVA 202 Query: 189 GVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPAEIQ 248 G+ + ++ + L + +++EH+M + S+ +V VL +G LA+GT ++Q Sbjct: 203 GMTEQEMERTAE--LLTGLAGKQSVVVVEHDMGFVRSIARKVTVLHQGSVLAEGTMDQVQ 260 Query: 249 TNSQVLEAYLGK 260 ++ +V+E YLG+ Sbjct: 261 SDPKVIEVYLGE 272 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 277 Length adjustment: 25 Effective length of query: 235 Effective length of database: 252 Effective search space: 59220 Effective search space used: 59220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory