Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_043532123.1 JH15_RS15910 NAD-dependent epimerase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_000759345.1:WP_043532123.1 Length = 335 Score = 165 bits (417), Expect = 2e-45 Identities = 110/334 (32%), Positives = 170/334 (50%), Gaps = 29/334 (8%) Query: 1 MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNL-----EHLADNSAHVFVEA 55 M+ L+TG AGFIG + RL+ GH +VG+DN T+L ++L D VF++ Sbjct: 1 MKVLITGVAGFIGHAVAKRLVRLGHHIVGIDNLNNYYETSLKQARLDNLRDCDEIVFIKM 60 Query: 56 DIVTAD-LHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVR 114 D+V D + + + H+ ++V HLAAQ VR S+ +P A N+IG + + E R T V+ Sbjct: 61 DLVDKDSMTKLFQYHQFDIVIHLAAQAGVRYSLENPHAYADTNLIGHLNVLEGCRNTNVK 120 Query: 115 KIVHTSSGGSIYGTPPEYPTPETAPTD-PASPYAAGKVAGEIYLNTFRHLYGLDCSHIAP 173 +V+ SS SIYG + P E D P S YAA K A E+ +T+ HLY + + + Sbjct: 121 HLVYASS-SSIYGMNAKLPFSEADNVDHPVSLYAATKKANELMSHTYSHLYQIPTTGLRF 179 Query: 174 ANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSADVG 233 VYGP P + F + +L G+P V+ G +RD+ ++DD+V+ +RV + Sbjct: 180 FTVYGPWGRPD---MAMFKFTKCVLEGRPIDVYNYGDMSRDFTYIDDIVEGVIRVMHVIP 236 Query: 234 GG------------------LRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDL 275 G FNIG G S + AV AA G + P + GD+ Sbjct: 237 EGNEDWNPIKAKSDGSIAPYALFNIGHGSPVSLMEFIRAVEAATGREAICRYLPMQPGDV 296 Query: 276 KRSCLDIGLAERVLGWRPQIELADGVRRTVEYFR 309 +R+ D + G++PQ+ + +G R VE++R Sbjct: 297 QRTWADTEGLHQATGYQPQMGVVEGARLFVEWYR 330 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 335 Length adjustment: 28 Effective length of query: 286 Effective length of database: 307 Effective search space: 87802 Effective search space used: 87802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory