Align L-arabinonolactonase (characterized, see rationale)
to candidate WP_156105315.1 JH15_RS10355 hypothetical protein
Query= uniprot:A0A1I2AUG6 (300 letters) >NCBI__GCF_000759345.1:WP_156105315.1 Length = 211 Score = 91.3 bits (225), Expect = 2e-23 Identities = 57/141 (40%), Positives = 72/141 (51%), Gaps = 8/141 (5%) Query: 154 AFSPDGRTMYFCDSPSRVIQCCDYGD--RCGEPRVFARVDDERGEPDGSAVDAQGCLWNA 211 A SPDG T+Y D+ + +I D C R R +G PDG DA+G LW A Sbjct: 64 AISPDGGTLYHSDTAAGIIHAYDLAPDGECSNKREHIRFRPTQGYPDGMTCDAEGGLWVA 123 Query: 212 QWGLGRVVRYAPDGRVDRIVEVPATQPTRPAFGDSPLDTLYITSARDGLSSAALATQPLA 271 + GRV R+ PDG +D + +PA++ T FG LD LYIT+A S + LA Sbjct: 124 HFDGGRVSRFLPDGSLDETLTLPASRVTSCTFGGPELDQLYITTA-----SHERDREELA 178 Query: 272 GALFAADAGASGLPEPRFRGA 292 GALF G GLP P GA Sbjct: 179 GALFRIVPGVKGLP-PHANGA 198 Lambda K H 0.321 0.139 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 211 Length adjustment: 24 Effective length of query: 276 Effective length of database: 187 Effective search space: 51612 Effective search space used: 51612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory