Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_043529941.1 JH15_RS10285 SDR family oxidoreductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_000759345.1:WP_043529941.1 Length = 249 Score = 131 bits (329), Expect = 2e-35 Identities = 87/254 (34%), Positives = 132/254 (51%), Gaps = 15/254 (5%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKA 77 RL+ K L+T A QGIG A FAS+ AR+ +DI A K++ + G + H L Sbjct: 2 RLERKTALITAAGQGIGRATALRFASEGARVFATDIDAGKLDELKG---TPGIETHRL-- 56 Query: 78 DVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 DV + + ++A+ +D+L NCAG D L E DW A+++ + Sbjct: 57 DVLDPGAITSLAQELPP----LDILFNCAGHVASGDLLACDERDWEFSLALNVTAMYRMI 112 Query: 138 KAVLPQMIEQGVGSIINIASTHSS-HIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVN 196 +A LP M+E+G GSIIN+AS SS +P F Y K +LGLT+++ +Y +G+R N Sbjct: 113 RAFLPGMLERGSGSIINMASVASSLKGVPNRFAYGTTKAAVLGLTKSVAADYVGQGIRCN 172 Query: 197 AIAPGYIETQLNVDYWNGFADPYAERQRAL-----DLHPPRRIGQPIEVAMTAVFLASDE 251 AI PG +E+ + A+ + + P R+GQP E+A A +LA+DE Sbjct: 173 AICPGTVESPSLRERIRAQAEQQGRSEDEVYSEFTARQPLGRLGQPEEIAALATYLAADE 232 Query: 252 APFINASCITIDGG 265 + + + IDGG Sbjct: 233 SGYTTGTAQVIDGG 246 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 249 Length adjustment: 24 Effective length of query: 248 Effective length of database: 225 Effective search space: 55800 Effective search space used: 55800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory