Align 2-ketogluconokinase (EC 2.7.1.13) (characterized)
to candidate WP_043531553.1 JH15_RS14595 sugar kinase
Query= metacyc::MONOMER-12748 (320 letters) >NCBI__GCF_000759345.1:WP_043531553.1 Length = 327 Score = 357 bits (915), Expect = e-103 Identities = 187/310 (60%), Positives = 224/310 (72%), Gaps = 5/310 (1%) Query: 5 DILSFGETMAMFVAEHGGDLAQVQHFHKRIAGADSNVAIGLARLGFKVAWLSRVGNDSLG 64 +IL+FGE M +FVA+ G + ++HF + IAGAD+NVAIGLARLGF V WLSRVGNDS G Sbjct: 9 EILAFGEAMTLFVADAPGAMPDIEHFQRGIAGADTNVAIGLARLGFHVGWLSRVGNDSFG 68 Query: 65 RFVLDTLRAEGLDCRFVRCDPIHPTGFQLKSREDGGDDPRVEYFRRGSAASHLAISDLDP 124 ++ TL EGLDCR++ D H TG K R GG DPRVEYFR+GSAASHL+ D Sbjct: 69 DYIHRTLETEGLDCRYLTHDEEHSTGLVFKERASGGADPRVEYFRKGSAASHLSPDDAAS 128 Query: 125 ALLRA-RHLHATGIPPALSDSARELSGHLMHTQRSAGHSVSFDPNLRPALWPSEALMIRE 183 + RHLHATGIPPA+S S RELS H++ R G S+SFDPNLRP+LW SE M Sbjct: 129 VDFSSMRHLHATGIPPAVSASCRELSWHMLDQARQHGASISFDPNLRPSLWASEEEMRET 188 Query: 184 INRLAALAHWVLPGLAEGRLLTGRDDPADIAAFYLDQGAEAVVIKLGAHGAYYRTQL--- 240 IN +AA A WVLPGLAEGRLLTGR+DP DIA FYL++GA+AV+IKLG G+YYR + Sbjct: 189 INAMAAKADWVLPGLAEGRLLTGREDPHDIADFYLERGAKAVIIKLGPEGSYYRGTMNGH 248 Query: 241 -DAGFVEGVPVAQVVDTVGAGDGFAVGLISALLESRGILEAVQRANWIGSRAVQSRGDME 299 ++ V G V +VVDTVGAGDGFAVG+ISALL+ EAV+R N IG+ AVQ+ GDME Sbjct: 249 EESFTVHGFEVDEVVDTVGAGDGFAVGVISALLDGLSPREAVRRGNLIGAEAVQALGDME 308 Query: 300 GLPLRHELPE 309 GLP R L E Sbjct: 309 GLPSRQRLSE 318 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 327 Length adjustment: 28 Effective length of query: 292 Effective length of database: 299 Effective search space: 87308 Effective search space used: 87308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory