Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_043532367.1 JH15_RS16675 urea ABC transporter ATP-binding protein UrtD
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000759345.1:WP_043532367.1 Length = 277 Score = 149 bits (375), Expect = 8e-41 Identities = 93/268 (34%), Positives = 156/268 (58%), Gaps = 12/268 (4%) Query: 3 DRITPAEN-LGSPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLF 61 D + P+E+ + +L + ++ SF G +A++ ++ + +G + +IGPNGAGKTT+ Sbjct: 15 DFLVPSESPVDVRHGPILYMEDVTVSFDGFKAINDLNLTIDDGELRCIIGPNGAGKTTMM 74 Query: 62 NLLSNFIRPDQGEVLFNG-DSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQH 120 ++++ RPD G V F ++ L+ +IA G R FQ V LTV EN+ LA Sbjct: 75 DIITGKTRPDTGSVWFGSRHNLLTLSEPEIARLGIGRKFQKPTVFEALTVFENLELA--M 132 Query: 121 QTGEKFLPRLINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARA 180 T ++ LP L+ R+ + R ++ + M +GL A+ + AG LS GQ++ LE+ Sbjct: 133 ATDKRVLPTLM--ARMNGDIRDRIDEVLGM---IGLEAQYRQPAGILSHGQKQWLEIGML 187 Query: 181 LMSNPKLILLDEPAAGVNPTLIGQICEHIVNW-NRQGITFLVIEHNMDVIMTLCHHVWVL 239 LM P+L+L+DEP AG+ + + E + +Q + +V+EH+M + ++ V VL Sbjct: 188 LMQRPRLLLVDEPVAGMTEQEMERTAELLTGLAGKQSV--VVVEHDMGFVRSIARKVTVL 245 Query: 240 AEGRNLADGTPEQIQSDPRVLEAYLGDS 267 +G LA+GT +Q+QSDP+V+E YLG+S Sbjct: 246 HQGSVLAEGTMDQVQSDPKVIEVYLGES 273 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 277 Length adjustment: 25 Effective length of query: 242 Effective length of database: 252 Effective search space: 60984 Effective search space used: 60984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory