Align Histidine transport ATP-binding protein HisP (characterized)
to candidate WP_043531904.1 JH15_RS15200 amino acid ABC transporter ATP-binding protein
Query= SwissProt::P02915 (258 letters) >NCBI__GCF_000759345.1:WP_043531904.1 Length = 246 Score = 242 bits (617), Expect = 6e-69 Identities = 135/247 (54%), Positives = 166/247 (67%), Gaps = 14/247 (5%) Query: 7 LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVN 66 L V ++ K Y G EVLKG+S G+ +IG SGSGKST LRCIN L P G I +N Sbjct: 7 LDVQEVKKAYDGVEVLKGISFGLYRGETKVLIGPSGSGKSTLLRCINQLTVPDAGRIYLN 66 Query: 67 GQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 126 G+ +V D N + +R R+ VFQ FNL+SH+TVL+NV I+V G++K Sbjct: 67 GK------------EVLDSN-IDTMRARMGFVFQDFNLFSHLTVLDNVRICQIKVNGINK 113 Query: 127 HDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDP 186 DA +RA + L +VG+ ERA YP LSGGQQQRVSIARALAM+PDVLLFDEPTSALDP Sbjct: 114 DDATQRAHRELERVGLSERANA-YPAELSGGQQQRVSIARALAMDPDVLLFDEPTSALDP 172 Query: 187 ELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQS 246 EL GEV+R+MQQLA EG TMVVVTHEM FAR + +IF+ G I E+G P ++F S Sbjct: 173 ELTGEVVRVMQQLAVEGMTMVVVTHEMSFARQAADEIIFMENGHIVEQGTPAELFDASAS 232 Query: 247 PRLQQFL 253 R + FL Sbjct: 233 DRTRAFL 239 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 246 Length adjustment: 24 Effective length of query: 234 Effective length of database: 222 Effective search space: 51948 Effective search space used: 51948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory