Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_043527041.1 JH15_RS03500 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000759345.1:WP_043527041.1 Length = 354 Score = 323 bits (828), Expect = 5e-93 Identities = 187/367 (50%), Positives = 239/367 (65%), Gaps = 30/367 (8%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA + L + KTY G E VK +L+I D EF V VGPSGCGK+T LRM+AGLE IT+G Sbjct: 1 MASIQLTGLKKTYAGNVE-AVKGIDLEIADGEFVVLVGPSGCGKSTLLRMVAGLETITDG 59 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 L I DR VND+ P +RDIAMVFQNYALYPHMTV+ N+A+GLK R V + EI+RRV +AA Sbjct: 60 TLKIDDRVVNDLEPAERDIAMVFQNYALYPHMTVFGNLAYGLKNRGVKREEIERRVHDAA 119 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 +L+I L+RKP+ LSGGQRQRVA+GRA+VREP FL DEPLSNLDAKLRVQMR EI++ Sbjct: 120 AMLEIEPFLERKPRKLSGGQRQRVAMGRALVREPSAFLFDEPLSNLDAKLRVQMRVEIKQ 179 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 L +RL+TT +YVTHDQ EA+T+GDR+VV+ G I+Q TP VY +P +MFVA FIGSPA Sbjct: 180 LQRRLKTTSLYVTHDQLEALTLGDRLVVLNGGSIEQVGTPMEVYEKPASMFVATFIGSPA 239 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFM 300 MN + P LR G G+L A V+G+RP+DL E Sbjct: 240 MNML---------------PVAYLR-ERGANGLLDHLAA--DTDVIGIRPDDLRIEA--- 278 Query: 301 TTYPDS---VLQMQVEVVEHMGSEVYLHTSI--GPNTIVARVNPRHVYHVGSSVKLAIDL 355 PD V+ VE+ E G+E +L+ S+ V R + R G +++ + Sbjct: 279 ---PDEDHLVVTGTVELFEAAGAESHLYVSLEGSDQPTVIRTSARPPVAEGETMRFHVLP 335 Query: 356 NKIHIFD 362 + +H F+ Sbjct: 336 SALHPFN 342 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 354 Length adjustment: 30 Effective length of query: 354 Effective length of database: 324 Effective search space: 114696 Effective search space used: 114696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory