Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_081948971.1 JH15_RS09915 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000759345.1:WP_081948971.1 Length = 389 Score = 285 bits (730), Expect = 1e-81 Identities = 163/344 (47%), Positives = 212/344 (61%), Gaps = 18/344 (5%) Query: 3 KITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMI 62 +I L NV K++G+ + + D+ G+FV+ +GPSGCGKST LR+IAGLE S G+I I Sbjct: 7 RIRLENVSKQWGDTPAVDGISFDVTPGQFVILLGPSGCGKSTTLRMIAGLEQASSGRIHI 66 Query: 63 DGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKILN 122 RD T +PP RGL+MVFQ+YAL+PH+ V +NI F LR ++ E R++ AAK+++ Sbjct: 67 GDRDVTSLPPGDRGLSMVFQNYALFPHLNVAENIVFGLRSRRVAGAERRERLARAAKLVD 126 Query: 123 LTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELHQS 182 L YLDR+P QLSGGQRQRVA+ RAI+ E L DEPLSNLDA LR MR EI L + Sbjct: 127 LEAYLDRKPAQLSGGQRQRVALARAIIAEHPICLMDEPLSNLDARLRGEMRREIKALQRR 186 Query: 183 LETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKMNL- 241 L T+IYVTHDQVEAM+M D+++++ GRI Q +P LYR PA F A FIGSP MNL Sbjct: 187 LGMTVIYVTHDQVEAMSMGDRVILMQGGRIVQDDTPSELYRRPATAFAASFIGSPAMNLL 246 Query: 242 ----------IEGP---EAAKHGA--TTIGIRPEHIDLSR-EAGAWEGEVGVSEHLGSDT 285 IEG A H A + IG+RPE I ++ +A E +E+LG+D+ Sbjct: 247 PLAAASDGAVIEGEPRCAVASHEAVGSQIGVRPEDIRIAAWDAPGVPAEWQDTEYLGADS 306 Query: 286 FLHVHVAGMPTLTVRTGGEFGVHHGDRVWLTPQADKIHRFGADG 329 + + V G L R G H R L A+ H F ADG Sbjct: 307 IVRLKV-GEHELRARLDGPAPEHPPGRCRLQWSAEAAHFFDADG 349 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 389 Length adjustment: 29 Effective length of query: 303 Effective length of database: 360 Effective search space: 109080 Effective search space used: 109080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory