Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_043529645.1 JH15_RS09325 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_000759345.1:WP_043529645.1 Length = 226 Score = 192 bits (488), Expect = 5e-54 Identities = 104/232 (44%), Positives = 153/232 (65%), Gaps = 8/232 (3%) Query: 1 MLKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITF 60 ML+++G+ TFYG +AL GVD+++ AGE+V+L+G NG GK+T + ++ G A G + F Sbjct: 1 MLRIAGLETFYGPSQALFGVDLDVAAGEMVALMGRNGMGKTTTIRSLFGLTPAARGTVEF 60 Query: 61 EGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFANELERVLTLF 120 E +D+ ++P Y + RLG+ PEGRR FP +SV ENLQ TA+ G + L RV LF Sbjct: 61 ESRDVRRLPAYRIARLGLGLVPEGRRCFPNLSVRENLQ---ATARAGEWG--LARVERLF 115 Query: 121 PRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDIN 180 PRL ER +Q A T+SGGEQQMLAIGRALM+ PRLL+LDE + GLAP++ K+I+ A++ + Sbjct: 116 PRLAERATQSARTLSGGEQQMLAIGRALMTNPRLLVLDEATEGLAPVIRKEIWVAIRTL- 174 Query: 181 REQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 +EQ + +V++ L + R ++ G G +EL ++ +R YL Sbjct: 175 KEQGQSTLIVDKTLSELLPVVDRCIILEKGLTAWRGLPSEL--DDTIRDRYL 224 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 226 Length adjustment: 23 Effective length of query: 213 Effective length of database: 203 Effective search space: 43239 Effective search space used: 43239 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory