Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_043532365.1 JH15_RS16670 urea ABC transporter ATP-binding subunit UrtE
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000759345.1:WP_043532365.1 Length = 232 Score = 141 bits (355), Expect = 1e-38 Identities = 79/219 (36%), Positives = 131/219 (59%), Gaps = 4/219 (1%) Query: 9 LLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEY 68 +L+V L YG + ++ ++ +GE ++G NG GKTT +K + G + DG+I + Sbjct: 1 MLKVHKLNQYYGQSHTLWDLEVDIPQGECTCVMGRNGVGKTTLLKCVMGEEATRDGSIRF 60 Query: 69 LGK-SIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFT 127 + + + D + G+ VP+GR +F +T+ ENL+ G R+D G+ E+++ Sbjct: 61 AEEVELTERRVEDRSRLGIGYVPQGRQIFPMLTVEENLRTGLAARRD--GMRTIPERIYE 118 Query: 128 IFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIFEVVRD 187 +FP L+E + + G +SGG+QQ LA+GRAL+ +P++L+LDEP G+ P +V +I EV+R Sbjct: 119 LFPVLKEMRHRRGGDLSGGQQQQLAIGRALVLEPRLLILDEPGEGIQPNIVAQIGEVIRR 178 Query: 188 VYAL-GVTIVLVEQNASRALAIADRGYVMESGLITMTGP 225 + A G+T++LVEQ A ADR +M+ G GP Sbjct: 179 LIAEDGLTVLLVEQKLPFARKYADRFVIMDRGRQVAKGP 217 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 232 Length adjustment: 23 Effective length of query: 219 Effective length of database: 209 Effective search space: 45771 Effective search space used: 45771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory