Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_043529643.1 JH15_RS09320 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000759345.1:WP_043529643.1 Length = 247 Score = 150 bits (378), Expect = 3e-41 Identities = 92/254 (36%), Positives = 143/254 (56%), Gaps = 7/254 (2%) Query: 1 MSRPILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGG 60 MS +LE+ L RFG L A V L + ++ ++IGPNGAGK+T+ + G P G Sbjct: 1 MSEAVLELRNLHKRFGALQATRDVTLDLRPGEIHALIGPNGAGKSTLIGQIAGHIAPDEG 60 Query: 61 LIRLDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKT 120 IRL E+I GL + AR+G+ R+FQ L ++ + N++VA +F F Sbjct: 61 QIRLSAEDITGLSVAERARRGLGRSFQVSSLADSLSVLRNVMVAVQAIQGHSF---RFWK 117 Query: 121 PAFRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEP 180 P R + +E A + + L+ A+ L++G++R++E+A + PR L+LDEP Sbjct: 118 PVDR--DASLIEPARAAIARMQLSSRADTPVSELSHGERRQVEVACALALNPRALLLDEP 175 Query: 181 AAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQ 240 AGL P+ + L L+ L+ E V +LLIEHDM V ++D + V+ G +A GT ++ Sbjct: 176 MAGLGPEGSLKLTELLETLKLE--VPILLIEHDMDAVFRLADRVTVLVSGEVIAHGTCDE 233 Query: 241 IRDNPDVIKAYLGE 254 IR +P V +AYLG+ Sbjct: 234 IRTHPRVREAYLGD 247 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 247 Length adjustment: 24 Effective length of query: 231 Effective length of database: 223 Effective search space: 51513 Effective search space used: 51513 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory