Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate WP_043527897.1 JH15_RS05910 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >NCBI__GCF_000759345.1:WP_043527897.1 Length = 284 Score = 336 bits (861), Expect = 4e-97 Identities = 157/279 (56%), Positives = 204/279 (73%), Gaps = 3/279 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT 60 +E+ + F GW +R+RH S L+C M F+I+LPP + T P+++WLSGLTC DENF Sbjct: 7 LELESATKSFGGWIKRYRHHSRALDCEMVFAIYLPPQAEETRVPLMWWLSGLTCTDENFM 66 Query: 61 TKAGAQRVAAELGIVLVMPDTSPRGEKVAND-DGYDLGQGAGFYLNATQPPWATHYRMYD 119 K+GAQRVAAELGI +V PDTSPRG + + D YD G GAGFYLNA Q PWA HYRMYD Sbjct: 67 QKSGAQRVAAELGIAIVCPDTSPRGLDLPGEHDSYDFGSGAGFYLNAKQEPWARHYRMYD 126 Query: 120 YLRDELPALVQSQFNVSDRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVPW 179 Y+ +ELP++V+ F V+ R +ISGHSMGG GAL++AL+ PG++ +VSAFAPIVNP PW Sbjct: 127 YVNEELPSVVRQHFPVNGRESISGHSMGGLGALVLALRQPGRFAAVSAFAPIVNPMDAPW 186 Query: 180 GIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEAA 239 G KAF +YLGE++ W ++D+C L+ ++ P IDQG+ D FL +QL+P L Sbjct: 187 GQKAFKNYLGEERGEWRQYDACELVAKGVSRQ--PLFIDQGEADNFLDEQLKPERLETVC 244 Query: 240 RQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYLLK 278 + P+TLR QPGYDHSY+FIA+FIEDHLR+HA+YL K Sbjct: 245 KTHDHPLTLRRQPGYDHSYFFIATFIEDHLRYHAEYLFK 283 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 284 Length adjustment: 26 Effective length of query: 252 Effective length of database: 258 Effective search space: 65016 Effective search space used: 65016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory