Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate WP_052383965.1 JH15_RS05605 aldo/keto reductase
Query= SwissProt::O32210 (276 letters) >NCBI__GCF_000759345.1:WP_052383965.1 Length = 268 Score = 153 bits (386), Expect = 4e-42 Identities = 91/259 (35%), Positives = 140/259 (54%), Gaps = 2/259 (0%) Query: 17 MPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELFI 76 +P G G+ ++ + + + AA + G+R+ DTA +Y NE +G +++ G+ R+ +F+ Sbjct: 5 LPPIGFGLDELAD-QQVARLIPAAWQAGFRAFDTAQLYGNEAALGRALRDIGMDRDAVFV 63 Query: 77 TSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDK-YKDTWRALEKLYKDGKI 135 T+KV N L + ++SLERL+LD +DL L+HWPG + L ++ G Sbjct: 64 TTKVMNSHFSESRFLPSVQESLERLELDRVDLLLVHWPGHGMPIERQIELLNEVRARGWT 123 Query: 136 RAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQG 195 R IGVSN+ L ++ +E NQVE HP L Q LR + G+ L + + G Sbjct: 124 RHIGVSNYNATQLARAVEISEAPIATNQVEIHPYLDQSTLRKHAHELGVPLTGFFVMAMG 183 Query: 196 QLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDM 255 + + VL +I H K+ AQV+LRW Q G V + +S + RI EN IFDF LS ++M Sbjct: 184 AVPRDPVLARIGAAHGKNAAQVVLRWVHQKGDVPLTRSTRPTRIAENIAIFDFALSSDEM 243 Query: 256 DKIDALNKDERVGPNPDEL 274 ID L + +PD L Sbjct: 244 AVIDGLARTGGRILSPDNL 262 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 268 Length adjustment: 25 Effective length of query: 251 Effective length of database: 243 Effective search space: 60993 Effective search space used: 60993 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory