Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_043532471.1 JH15_RS16990 acetyl-CoA C-acyltransferase FadA
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_000759345.1:WP_043532471.1 Length = 392 Score = 288 bits (737), Expect = 2e-82 Identities = 168/403 (41%), Positives = 241/403 (59%), Gaps = 22/403 (5%) Query: 3 EALIIDAVRTPIGRYA-GALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQAG 61 + +++D VRT + + GA +VRA++L A ++AL R+ LD + VDDVI+GC NQ Sbjct: 7 DIVVVDGVRTAMAKAKNGAFRNVRAENLSASVMQALFDRNAGLDPNEVDDVIWGCVNQTL 66 Query: 62 EDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMS 121 E + N+AR AA++ G+P SVP T+NRLCGS + A+ AA ++ G + GGVE M Sbjct: 67 EQSMNIARNAAIMTGIPRSVPAQTVNRLCGSSMTALHIAAANIKAGMGDFYIIGGVEHME 126 Query: 122 RAPFVMGKS-EQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRAD 180 P G A + A M G TAE ++ ++R D Sbjct: 127 HVPMAHGVDVNPAASKYA-----------AKAAMMMGL-------TAELLSKMHGVTRED 168 Query: 181 QDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGT 240 QD F +RS +A AA G EIV +E +G ++++HDE R D +LE++AKL Sbjct: 169 QDKFGVRSHQRAYAANQQGYFDNEIVGIEGHDTQGFKRLIKHDEVVRIDASLEEMAKLKP 228 Query: 241 PF-RQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGP 299 F + G+V+AG +S ++ GA A+ + S E AQ GL+ ARV+ AG + IMG GP Sbjct: 229 VFDPRSGTVSAGTSSALSVGASAMAVMSYERAQALGLQPIARVLSTGVAGCDASIMGYGP 288 Query: 300 VPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADD-DERVNPNGGAIALGHP 358 VPA++K L+ GL+ D+ +ELNEAFAAQ + VL++LG D DE+VN NGGAIALGHP Sbjct: 289 VPASKKALKAAGLSSKDIQTVELNEAFAAQAIPVLKDLGFYDAMDEKVNLNGGAIALGHP 348 Query: 359 LGMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401 LG SG+R+ TT L+ ++++ L TMCIG+GQG+A + ER+ Sbjct: 349 LGCSGSRICTTLLNVMQQQDTTLGLATMCIGMGQGVATVFERL 391 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 392 Length adjustment: 31 Effective length of query: 370 Effective length of database: 361 Effective search space: 133570 Effective search space used: 133570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory