Align malonate-semialdehyde dehydrogenase (EC 1.2.1.15); malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18); methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_043532311.1 JH15_RS16505 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::A0A081YAY7 (498 letters) >NCBI__GCF_000759345.1:WP_043532311.1 Length = 487 Score = 241 bits (614), Expect = 5e-68 Identities = 144/455 (31%), Positives = 240/455 (52%), Gaps = 8/455 (1%) Query: 6 HLIGGELIADTGRTADVFNPSTGEAVRKVPLADRETMQQAIDAAKAAFPAWRNTPPAKRA 65 ++ G + AD+G DVFNP+ GE + +VP R ++AI AA AAFPAWR +RA Sbjct: 15 YIDGSWVAADSGEQIDVFNPANGEVIGRVPRLGRAETERAITAADAAFPAWRAHTAQERA 74 Query: 66 QVLFRFKQLLEANEERIVKLISEEHGKTIEDAAGELKRGIENVEYATAAPEILKGEYSRN 125 +L ++ L+ ++E + +++ E GK +++AAGE+ + + + GE Sbjct: 75 DILMKWHDLMHEHQEELATIMTLEQGKPLKEAAGEIAYAASFLRWFAEEARRMYGETIPA 134 Query: 126 VGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAIACGNTFILKPSERDPSSTLLIA 185 PN QP+GVV ITP+NFPA + A+A G ++KP+ + P S +A Sbjct: 135 AKPNQRIVITKQPVGVVGAITPWNFPAAMITRKVGAALAAGCPIVVKPASQTPFSATALA 194 Query: 186 ELFHEAGLPKGVLNVVHGD-KGAVDALIEAPEVKALSFVGSTPIAEYIYSEGTKRGKRVQ 244 L AG+P+GV NVV G + AL E+PEV+ ++F GST + + S+ ++ +++ Sbjct: 195 LLAERAGVPRGVFNVVTGSAREIAAALTESPEVRKITFTGSTEVGRQLMSQASQHIQKIS 254 Query: 245 ALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCMAISVAVCVGDQIADALVQKL-VP 303 G ++ DADLD AV M A + + G+ C+ + V + +A +KL V Sbjct: 255 LELGGNAPFIVFEDADLDAAVDGAMAAKFRNGGQTCVCTN-RFLVQSSVVNAFCEKLAVA 313 Query: 304 QIKGLKIGAGTSCGLDMGPLVTGAARDKVTGYIDTGVAQGAELVVDGRGYKVAGHENGFF 363 L++G G +++GPL+ +KV+ ++ V +GAEL++ G + + G+ F Sbjct: 314 MNSELRVGDGLKDDVNIGPLIDADGVEKVSAHVHDAVDKGAELLLGGNPHPLGGN----F 369 Query: 364 LGGTLFDRVTPEMTIYKEEIFGPVLCIVRVNSLEEAMQLINDHEYGNGTCIFTRDGEAAR 423 TL + +M + +EE FGP+ + + E+A+ + ND ++G + ++RD Sbjct: 370 FTPTLVNGANADMLVAQEETFGPLAAVFPFDDEEDAVAMANDTQFGLASYFYSRDLARVW 429 Query: 424 LFCDEIEVGMVGVNVPLPVPVAYHSFGGWKRSLFG 458 + +E GMVG+N L + A FGG K S G Sbjct: 430 RVAESLEYGMVGINTGL-ISNAAAPFGGVKASGLG 463 Lambda K H 0.319 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 595 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 498 Length of database: 487 Length adjustment: 34 Effective length of query: 464 Effective length of database: 453 Effective search space: 210192 Effective search space used: 210192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory