Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_043527041.1 JH15_RS03500 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000759345.1:WP_043527041.1 Length = 354 Score = 308 bits (788), Expect = 2e-88 Identities = 175/365 (47%), Positives = 231/365 (63%), Gaps = 22/365 (6%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA I L K YAG + +DL I DGEFVVL+GPSGCGKST+LRM+AGLE I+ GT Sbjct: 1 MASIQLTGLKKTYAGNVEAVKGIDLEIADGEFVVLVGPSGCGKSTLLRMVAGLETITDGT 60 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 L+I VVNDL ER++AMVFQNYALYPHM+V+ N+A+GL+ EI+RRV + AA Sbjct: 61 LKIDDRVVNDLEPAERDIAMVFQNYALYPHMTVFGNLAYGLKNRGVKREEIERRVHDAAA 120 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 +L +E LERKPR +SGGQ+QR A+ RA+++ PS FLFDEPLSNLDAKLR Q+R +IK+L Sbjct: 121 MLEIEPFLERKPRKLSGGQRQRVAMGRALVREPSAFLFDEPLSNLDAKLRVQMRVEIKQL 180 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 +RL+TT++YVTHDQLEA+TL DR++++ G I Q G+P E+Y P ++F A FIG+PAM Sbjct: 181 QRRLKTTSLYVTHDQLEALTLGDRLVVLNGGSIEQVGTPMEVYEKPASMFVATFIGSPAM 240 Query: 241 NFLSGTVQRQDGQLFIETAHQRWALTGERFSRLRHAMAVK--LAVRPDHVRIAGEREPAA 298 N L R+ G + L H A + +RPD +RI E Sbjct: 241 NMLPVAYLRERGANGL----------------LDHLAADTDVIGIRPDDLRIEAPDED-- 282 Query: 299 SLTCPVSVELVEILGADA-LLTTRCGDQTLTALVPADRLP-QPGATLTLALDQHELHVFD 356 L +VEL E GA++ L + G T + + R P G T+ + LH F+ Sbjct: 283 HLVVTGTVELFEAAGAESHLYVSLEGSDQPTVIRTSARPPVAEGETMRFHVLPSALHPFN 342 Query: 357 VESGE 361 SG+ Sbjct: 343 QASGK 347 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 354 Length adjustment: 30 Effective length of query: 376 Effective length of database: 324 Effective search space: 121824 Effective search space used: 121824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory