Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate WP_033100343.1 JG50_RS0106665 acetylornithine transaminase
Query= SwissProt::P50457 (421 letters) >NCBI__GCF_000763315.1:WP_033100343.1 Length = 393 Score = 194 bits (492), Expect = 5e-54 Identities = 129/393 (32%), Positives = 188/393 (47%), Gaps = 41/393 (10%) Query: 32 ATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTA--YQIVPYESYVTLA 89 A L+D +G Y+DFA+GI V N GH HP + A+ Q + HT+ +Q+ E A Sbjct: 20 AVLEDDQGKTYLDFASGIGVTNLGHNHPRIKQALLDQAEAVWHTSNLFQVPAQEK---AA 76 Query: 90 EKINALAPVSGQAKTAFFTTGAEAVENAVKIARAHT------GRPGVIAFSGGFHGRTYM 143 +++ L +G F +GAEA E A+K+AR P +I F G FHGRT Sbjct: 77 QRLTRL---TGLGAVFFCNSGAEANEAAIKLARKWAQEAKVISEPEIITFQGSFHGRTLA 133 Query: 144 TMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAII 203 T+ TG+ K GF P P VP+ L+A+++ AA++ Sbjct: 134 TLTATGQ-DKVKHGFSPLPRGFRTVPF----------GDLEAVKQA-----TGATTAAVL 177 Query: 204 FEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLM 263 E VQGEGG A + + + C E I+++ DEVQ+G RTG FA Y KPD++ Sbjct: 178 LELVQGEGGVRPANPDFIEGLSAWCKEKEILLMVDEVQTGIGRTGAAFAFQTYGLKPDVI 237 Query: 264 TMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERA 323 T AK L G P+ ++ + PG G T+ GNPLA A A AVL +++ + E Sbjct: 238 TAAKGLGNGFPIGAMIAREELKPVLGPGTHGTTFGGNPLATAVAAAVLAELEETPILEET 297 Query: 324 NQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQGL 383 G+ L D +P + +VR G M VEF+ P I L +GL Sbjct: 298 KAKGELFARLLTDELSGLPGMVSVRVKGLMAGVEFDQP---------VAPIITALLGKGL 348 Query: 384 LLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQ 416 + L G V+R L PL + + Q A+ +++ Sbjct: 349 VTLPAGE--KVLRLLPPLIVTEDQIRRAVHLIK 379 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 393 Length adjustment: 31 Effective length of query: 390 Effective length of database: 362 Effective search space: 141180 Effective search space used: 141180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory