Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_033099299.1 JG50_RS0101445 thiolase family protein
Query= BRENDA::Q0K368 (391 letters) >NCBI__GCF_000763315.1:WP_033099299.1 Length = 383 Score = 406 bits (1044), Expect = e-118 Identities = 220/392 (56%), Positives = 277/392 (70%), Gaps = 11/392 (2%) Query: 1 MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGADPALVEDVIMGCVSQVG 60 M EA IV AVRT GR+ G LSG P +LAA VL A+VER G P +VEDVIMGCVSQVG Sbjct: 1 MREAVIVEAVRTPIGRRNGVLSGIRPDELAAMVLRAVVERAGISPEMVEDVIMGCVSQVG 60 Query: 61 EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT 120 EQAG++ R A L + P VPGT++DRQCGSSQQA+HFAAQA+MSG MD+V+AAGVESM+ Sbjct: 61 EQAGDIGRIAALIAGYPVEVPGTTIDRQCGSSQQAVHFAAQAIMSGDMDVVVAAGVESMS 120 Query: 121 RVPMGLSSQLPAKNGFGVPKSPGIEARYPGVQFSQFTGAEMIARKYDLSREQLDAYALQS 180 RVPM + Q G S + +RY + +Q AE IA K+ SR QLD ++L S Sbjct: 121 RVPMFSNMQ-------GAEYSEKLTSRYEII--NQGLSAERIAAKWGFSRAQLDEFSLNS 171 Query: 181 HQRAIAATKSGRFTAEILPVEVRTADGANGEMHTTDEGVRYDATLESIGSVK-LIAEGGR 239 H++A+ A K GRF EILP+EV D + DEG R D ++E + ++ E G Sbjct: 172 HEKAVKAQKDGRFQQEILPLEVTLPDKGK-IIVDKDEGPREDTSMEKMRALSPSFQENGL 230 Query: 240 VTAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHAMTVIGHDPVVMLEAPLPATEVAL 299 + A ++SQI DGAA L++++ ++LG+KP RV A V+G DP +ML P+PAT+ L Sbjct: 231 IHAGNSSQISDGAAALLIMSRDKAEQLGLKPRFRVLARAVVGSDPTLMLTGPIPATKKVL 290 Query: 300 KKAGLRIGDIDLFEVNEAFAPVPLAWLKATGADPARLNVHGGAIALGHPLGGSGAKLMTT 359 +KAGL + +ID+FEVNEAFAPVPLAWLK TGADP +LN +GGAIALGHPLG SGA+LMTT Sbjct: 291 EKAGLTLSEIDVFEVNEAFAPVPLAWLKETGADPEKLNPNGGAIALGHPLGASGARLMTT 350 Query: 360 LVHALHTHGKRYGLQTMCEGGGLANVTIVERL 391 ++H L G RYGLQTMCEG G+AN TI+ERL Sbjct: 351 MMHELERRGGRYGLQTMCEGLGMANATIIERL 382 Lambda K H 0.317 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 383 Length adjustment: 30 Effective length of query: 361 Effective length of database: 353 Effective search space: 127433 Effective search space used: 127433 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory