Align Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized)
to candidate WP_033100143.1 JG50_RS0105800 amino acid permease
Query= TCDB::F2HQ25 (459 letters) >NCBI__GCF_000763315.1:WP_033100143.1 Length = 469 Score = 225 bits (573), Expect = 3e-63 Identities = 126/356 (35%), Positives = 203/356 (57%), Gaps = 12/356 (3%) Query: 5 QEKHEAQRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGP-SVIFAYILIGIAMFFFLR 63 +++ + ++ +++RH+ +IA+ G IGTG FL G TI GP + +YI+ GI M+ + Sbjct: 6 EQQGQLKQSMKSRHLFMIALGGVIGTGFFLSTGFTIGQAGPLGAVLSYIIGGICMYLIML 65 Query: 64 TIGEMLYNDPSQHSFLNFVTKYSGVRTGYFTQWSYWLVIVFVCISELTAIGTYIQFWLPQ 123 +GE+ PS SF ++ TK+ G TG+ W YWL ELT+IG ++ W P Sbjct: 66 CLGELSVAMPSAGSFQDYTTKFIGPATGFAVGWMYWLGWAVTVALELTSIGLTMKHWFPH 125 Query: 124 VPLWLIEIVMLALLFGLNTLNSRFFGETEFWFAMIKVAAIIGMIVTAIILVAGNFHYSTV 183 V +W+ ++ +LF +N +++ F ETEFWFA IKV II I+ + G H Sbjct: 126 VSIWVWCLIFGVVLFVVNAFSAKGFAETEFWFASIKVITIILFIILGGAAMFGFIH---- 181 Query: 184 LSGKTVHDSASLSNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPKKSL 243 L G ++A + F LFP+G N + + V F+F E IG+ + E+ NP+K++ Sbjct: 182 LKG---GEAAPYLSHFTQDGLFPNGFINVLVTMVAVNFSFQGTELIGIASGESENPQKTI 238 Query: 244 PKAINQIPVRILLFYVGALLAIMAIFNWHYIPADKSPFVMVFQLIGIKWAAALINFVVLT 303 P+AI Q R +LF+ A+ + + W +SPFV V IGI + A ++NFV+LT Sbjct: 239 PRAIRQTVWRTILFFGLAVFVLCGLLPWKQAGVMESPFVTVLDKIGIPYDADIMNFVILT 298 Query: 304 SAASALNSSLFSATRNMYSLAQQHDKGRLTP-FTKLSKAGIPINALYMATALSLLA 358 + S NS L++ TR +Y+L++ G +P F +L+K G+P NAL ++ A++ L+ Sbjct: 299 ALLSVANSGLYATTRMLYALSK---NGMASPVFGRLTKRGVPFNALILSMAIACLS 351 Lambda K H 0.329 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 469 Length adjustment: 33 Effective length of query: 426 Effective length of database: 436 Effective search space: 185736 Effective search space used: 185736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory