Protein WP_036139658.1 in Lysobacter daejeonensis GH1-9
Annotation: NCBI__GCF_000768355.1:WP_036139658.1
Length: 262 amino acids
Source: GCF_000768355.1 in NCBI
Candidate for 18 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 34% | 61% | 135.6 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-tryptophan catabolism | ecfA2 | lo | Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) | 36% | 79% | 126.7 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-proline catabolism | proV | lo | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 32% | 63% | 125.9 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 34% | 67% | 124 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 34% | 67% | 124 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| D-maltose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 68% | 122.1 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| D-maltose catabolism | thuK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 68% | 122.1 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| sucrose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 68% | 122.1 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| trehalose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 68% | 122.1 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| trehalose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 32% | 69% | 117.1 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-histidine catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 31% | 87% | 115.5 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-proline catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 31% | 87% | 115.5 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-isoleucine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 95% | 113.2 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-leucine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 95% | 113.2 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-phenylalanine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 95% | 113.2 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-proline catabolism | HSERO_RS00895 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 95% | 113.2 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-serine catabolism | Ac3H11_1693 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 95% | 113.2 | toluene tolerance protein Ttg2A | 51% | 256.1 |
| L-tyrosine catabolism | Ac3H11_1693 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 32% | 95% | 113.2 | toluene tolerance protein Ttg2A | 51% | 256.1 |
Sequence Analysis Tools
View WP_036139658.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTDTSPIVRLRDIRLERGGRAILRDINLDVPRGQVVAVLGPSGSGKSTLLSALTGQLVPA
AGTVEVLGRAVPRGERELLALRRGIGVLLQGNGLLTDLTAAENVGLPLRTHTELPEPVIR
RLVLMKLHAVGLQAAADAYPRELSGGMARRVALARALALDPPLMIYDEPLTGLDPIASGV
VMDLVRRLNDTLGLTSIVVTHHVHETLPVADQAIVIANGGIVFAGTPAELEASDDPFVRQ
FLKGEPDGPIAFDAAPRTPEAA
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory