Align methylmalonyl-CoA mutase (subunit 1/2) (EC 5.4.99.2) (characterized)
to candidate WP_036140096.1 N800_RS14225 methylmalonyl-CoA mutase family protein
Query= BRENDA::A4YIE3 (155 letters) >NCBI__GCF_000768355.1:WP_036140096.1 Length = 1160 Score = 77.4 bits (189), Expect = 7e-19 Identities = 40/116 (34%), Positives = 66/116 (56%), Gaps = 2/116 (1%) Query: 21 IKVVVAKLGLDGHDRGAKVIARALKDAGMEVVYTGLRQTPEQIVRTAIQEDADVIGISIL 80 ++ V A DGHD ++ R ++ G EV++ G ++ E +VR A+QEDAD I +S Sbjct: 18 LRFVTAASLFDGHDAAINIMRRLIQGQGAEVIHLGHNRSVEDVVRAALQEDADGIALSSY 77 Query: 81 SGAHLELMPKIVEALKKAGLDDVGLV--LGGVIPPEDIPKLKAMGVDDVFLPGTSL 134 G H+E +V+ LK+ G + + GG I PE+I +L+A GV+ ++ P + Sbjct: 78 QGGHVEYFKYMVDMLKERGAGHIRVFGGGGGTITPEEIRELQAYGVERIYHPNDGM 133 Lambda K H 0.319 0.140 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 155 Length of database: 1160 Length adjustment: 31 Effective length of query: 124 Effective length of database: 1129 Effective search space: 139996 Effective search space used: 139996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory