Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_035132405.1 Q763_RS06510 ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_000769915.1:WP_035132405.1 Length = 233 Score = 118 bits (296), Expect = 1e-31 Identities = 71/209 (33%), Positives = 115/209 (55%), Gaps = 10/209 (4%) Query: 18 GGDIVAV-EEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVS 76 G ++V V + I L I+ GE++ L+GPSG GKST + ++ L+T T G L + ++ +S Sbjct: 18 GNEVVKVLKGIDLTINKGEYVALMGPSGSGKSTLMNLLGCLDTPTGGTYILNGKDVSKMS 77 Query: 77 ------AQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGIS 130 ++++I VFQ++ L P + N++ + + G E +R + +G+ Sbjct: 78 DNELAEIRNKEIGFVFQTFNLLPRTTALDNVALPMVYA-GYKKPERNERASQVLTQVGLE 136 Query: 131 DLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELG 190 D +D KP QLSGGQ+QRVA+ RA+V P + L DEP NLD+K E+ + G Sbjct: 137 DRMDHKPNQLSGGQRQRVAVARALVNHPSIILADEPTGNLDSKTSVEIMKLFNEIHAN-G 195 Query: 191 VTTVYVTHDQTEAMTMGDRVAVLDDGELQ 219 T + VTH++ + RV L DG ++ Sbjct: 196 NTVILVTHEE-DIAAYAHRVIRLRDGVIE 223 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 233 Length adjustment: 26 Effective length of query: 357 Effective length of database: 207 Effective search space: 73899 Effective search space used: 73899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory