Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_035130886.1 Q763_RS02520 ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_000769915.1:WP_035130886.1 Length = 222 Score = 101 bits (252), Expect = 1e-26 Identities = 76/225 (33%), Positives = 126/225 (56%), Gaps = 14/225 (6%) Query: 4 LLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKP--DRG-D 60 +++ +++HK + ++ L GV + I KGEVV+++G +GAGK+TL++I+ KP ++G Sbjct: 1 MIQAKNIHKYYDSLHVLKGVDLHIKKGEVVSIVGASGAGKTTLLQILGTLDKPKSEKGTS 60 Query: 61 LVFEGKKVIFNSPNDA----RSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKK 116 L+ +G+ V+ N + A R+L + I+Q L P+ N+ + + K K + Sbjct: 61 LLIDGEDVL-NMKDKALSKFRNLKLGFIFQFHQLFPEFTALENVCIPAFIAGK---QKAE 116 Query: 117 MMEESKKLLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVE 176 E+KKLL+ L + IN K LSGG++Q VAVARA+ +I DEP+ L Sbjct: 117 TEAEAKKLLEYLGLS-HRINHKPGELSGGEQQRVAVARALINKPAVIFADEPSGNLDTHS 175 Query: 177 ARKVLELARNLK-KKGLGVLIITHNIIQGYEVADRIYVLDRGKII 220 A + L L+ + G +I+THN + +ADR V+ G+II Sbjct: 176 AENLHNLFFKLRDEMGQTFVIVTHN-EELANMADRKLVMSDGQII 219 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 222 Length adjustment: 23 Effective length of query: 228 Effective length of database: 199 Effective search space: 45372 Effective search space used: 45372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory