Align L-asparaginase (EC 3.5.1.1) (characterized)
to candidate WP_035135267.1 Q763_RS13660 asparaginase
Query= reanno::Pedo557:CA265_RS25090 (339 letters) >NCBI__GCF_000769915.1:WP_035135267.1 Length = 343 Score = 335 bits (859), Expect = 1e-96 Identities = 161/337 (47%), Positives = 244/337 (72%), Gaps = 2/337 (0%) Query: 4 ILIIYTGGTIGMVNDPTNGMLIPFDFQQIKENVPELSRLDYDLDVHSFNPVLDSSNMDPE 63 IL+IYTGGTIGMV D G+L F+F+++ + +PEL +LD +++ SF +DSSNMD Sbjct: 7 ILLIYTGGTIGMVKDFETGVLKAFNFKKLLQRIPELKQLDCNIETVSFETPIDSSNMDTA 66 Query: 64 IWKTLAELVYHKYDAYDGFVILHGSDTMAFTASALSFMLENLAKPVVLTGSQLPIGEIRT 123 W +A+++ YD +DGFVILHGSDTM+++ASALSFMLE L KPVV TGSQLPIG++RT Sbjct: 67 QWAQMAKMIEEHYDDFDGFVILHGSDTMSYSASALSFMLEGLNKPVVFTGSQLPIGDLRT 126 Query: 124 DAKENLITALEIAATKEDGKALFPEVCIYFDAQLFRGNRSIKYNSEKFEAFRSPNYPILA 183 DAKENLITA++IA+ + + EV +YF+ +L+RGNR+ K ++E F AF SPNYP LA Sbjct: 127 DAKENLITAIQIASLRHNNHPGVREVSLYFEYKLYRGNRTTKISAEHFNAFTSPNYPPLA 186 Query: 184 EAGVHLQFHRNYILKAT-EGELKLHTNFNSNIGVLKLYPGITPQAVQAITDS-KVDAIIL 241 E+GVHL+ ++ +LKA +L +H + N+ ++K++PGI + + +I ++ ++ ++L Sbjct: 187 ESGVHLKINKELLLKADGNRDLNVHYKLDDNVVIIKIFPGINEKVLTSILNTPELKGVVL 246 Query: 242 ETFGSGNTTTAQWFLDSLRQAILNGKIIIDISQCKKGSVQLGRYETSRELLKMGILSGYD 301 ET+GSGN T WF++ L+ AI G I++++QC GSV +G YETS +L ++G++SG D Sbjct: 247 ETYGSGNAPTEDWFINILQDAINRGLYIVNVTQCSGGSVNMGHYETSTKLKEIGVISGAD 306 Query: 302 LTFEATVTKLMFVMGLGLSIEESRKLMEESLRGELTK 338 +T EA +TKLM+++G G + + + + E + GEL++ Sbjct: 307 ITTEAAITKLMYMLGKGTPVADFKTIFEAPVCGELSQ 343 Lambda K H 0.319 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 343 Length adjustment: 29 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory