Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_035132405.1 Q763_RS06510 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000769915.1:WP_035132405.1 Length = 233 Score = 135 bits (341), Expect = 5e-37 Identities = 86/226 (38%), Positives = 127/226 (56%), Gaps = 10/226 (4%) Query: 1 MIELKNVNKYYGTHH----VLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSG 56 +I++K++ + + + VLK I+L++ +GE + ++GPSGSGKST + + L+ + G Sbjct: 5 IIDIKSITRNFPLGNEVVKVLKGIDLTINKGEYVALMGPSGSGKSTLMNLLGCLDTPTGG 64 Query: 57 EVVVNNL---VLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAE 113 ++N ++ EI K VFQ FNL P T L N+ L PM K E Sbjct: 65 TYILNGKDVSKMSDNELAEIRNKEIGFVFQTFNLLPRTTALDNVAL-PMVYAGYKKPERN 123 Query: 114 ETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQE 173 E A + L VGL D+ + P LSGGQ+QRVA+AR+L IL DEPT LD +T E Sbjct: 124 ERASQVLTQVGLEDRMDHKPNQLSGGQRQRVAVARALVNHPSIILADEPTGNLDSKTSVE 183 Query: 174 VLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENI 219 ++ + EI H + T+++VTHE A A R+I + DG I +NI Sbjct: 184 IMKLFNEI-HANGNTVILVTHEEDIA-AYAHRVIRLRDGVIESDNI 227 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 233 Length adjustment: 23 Effective length of query: 219 Effective length of database: 210 Effective search space: 45990 Effective search space used: 45990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory