Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_035132405.1 Q763_RS06510 ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_000769915.1:WP_035132405.1 Length = 233 Score = 101 bits (251), Expect = 2e-26 Identities = 75/232 (32%), Positives = 126/232 (54%), Gaps = 16/232 (6%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPG 104 I+++ ++ + GN ++K + + + KGE + ++G SGSGK+TL++ + P G Sbjct: 5 IIDIKSITRNFPLGNE-VVKVLKGIDLTINKGEYVALMGPSGSGKSTLMNLLGCLDTPTG 63 Query: 105 KIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGE 164 G I NG D+ M+ +E ++ K+I +V Q +LP + + A+ Sbjct: 64 ----GTYILNGKDVSKMSDNELAEIRNKEIGFVFQTFN-----LLPRTTALDNVALPMVY 114 Query: 165 ADKKRVI--ERASELLKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEP 222 A K+ ERAS++L VGL+ K P QLSGG +QRV +A +L+ +P +IL DEP Sbjct: 115 AGYKKPERNERASQVLTQVGLEDRMDHK--PNQLSGGQRQRVAVARALVNHPSIILADEP 172 Query: 223 TSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYV 274 T LD ++KL I+ G T++ VTH+ +IA A+R++ + G + Sbjct: 173 TGNLDSKTSVEIMKLFNEIHAN-GNTVILVTHE-EDIAAYAHRVIRLRDGVI 222 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 233 Length adjustment: 26 Effective length of query: 336 Effective length of database: 207 Effective search space: 69552 Effective search space used: 69552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory