Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_052123206.1 Q763_RS03145 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q8VWZ1 (503 letters) >NCBI__GCF_000769915.1:WP_052123206.1 Length = 451 Score = 234 bits (598), Expect = 4e-66 Identities = 134/428 (31%), Positives = 225/428 (52%), Gaps = 10/428 (2%) Query: 58 ISRKNGRDWSAASGSLRARYLRAIAAKIKEKKDELGKLESIDCGKPLEEALADLDDVVAC 117 IS+K+ R W R ++++ + + +K+ L + S + GKPL++A+A++ Sbjct: 30 ISQKSFRKWGKTPLKKRVKFIKNLIFVLTKKQHLLAEKCSQEMGKPLKQAIAEVKKCSLL 89 Query: 118 FEYYAGLAEELDSKQKAPISLPMDTFKSYILKEPIGVVALITPWNYPFLMATWKIAPALA 177 E+Y AE+ +K + D +S++ EP+GV+ + PWN+P+ PA+ Sbjct: 90 CEFYLEHAEKFLQDEK----ISSDAGESFVTHEPLGVILGVMPWNFPYWQVFRFAIPAII 145 Query: 178 AGCAAILKPSELASVTCLELGEICKEVGLPRGVLNIVTGLGHEAGASLASHPDVDKISFT 237 AG ++K + + L E+ KE P + + G + ++ +P + +S T Sbjct: 146 AGNTVVVKHASNVAECAQLLEELFKEAEFPEMIYQNLQISGSQV-KNVIENPIIKGVSLT 204 Query: 238 GSSATGSKIMTTAAQLVKPVSLELGGKSPIVVFEDVDLDKVAEWTVFGCFFTNGQICSAT 297 GS G+ + +TAA L+K LELGG + +V ED DLDK V GQ C A Sbjct: 205 GSEKAGATVASTAANLIKKSVLELGGSNAFIVLEDADLDKAVPVAVTARMQNTGQSCIAA 264 Query: 298 SRLIVHESIAVEFVDKLVKWAENIKISDPLEEGCRLGPIVSEAQYKKVLNCISSAKSEGA 357 R +VH S+ EF+ + + +K +P++E +GP+ + + ++ + GA Sbjct: 265 KRFLVHSSLYDEFLKRFTTEVKKLKSGNPMDEDTDIGPLARVDLAEDIEKQVNKSVDMGA 324 Query: 358 TILTGGRRPEHLKKGYFVEPTIITDVTTSMQIWREEVFGPVLAVKTFSTEEEAINLANDT 417 ++ GGRR F EPTI+ +VT+ M ++ EEVFGPV V F + EEA+ L+N + Sbjct: 325 KVIIGGRR-----NNAFYEPTIVVNVTSDMPLFNEEVFGPVAPVIAFDSFEEAVKLSNYS 379 Query: 418 HYGLGSAVMSNDLERCERLSKALQAGIVWINCAQPSFIQAPWGGIKRSGFGRELGEWGLE 477 +GLG + + D+E + + G V+IN S P+GG+K+SGFGREL E G++ Sbjct: 380 DFGLGVNIFTEDIEGIKEKISLFEEGAVFINAMVKSDPALPFGGVKKSGFGRELAENGIK 439 Query: 478 NYLSVKQV 485 +++VK V Sbjct: 440 EFVNVKTV 447 Lambda K H 0.317 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 503 Length of database: 451 Length adjustment: 33 Effective length of query: 470 Effective length of database: 418 Effective search space: 196460 Effective search space used: 196460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory