Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_035131108.1 Q763_RS03170 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_000769915.1:WP_035131108.1 Length = 248 Score = 126 bits (316), Expect = 5e-34 Identities = 89/256 (34%), Positives = 136/256 (53%), Gaps = 22/256 (8%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHA-GV------A 64 G +I+GA+ GIG IAQ F GANV A + A+T +L A G+ + Sbjct: 6 GKTAIITGASRGIGRGIAQVFAKHGANVAFTYSSSA--EAAKTLEDELTALGIKAKGYQS 63 Query: 65 DVSDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYF 124 + +D + +++D+ G +D+LINNAGI + + ++++ I NL S F Sbjct: 64 NAADFNEAQKLVDEVVETFGTVDILINNAGIT-KDNLLMRISEEDFDKVIEVNLKSVFN- 121 Query: 125 LRKAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRV 184 + KAV + II M+SV G G A +T YAASK ++G KS+A+ELG N+R Sbjct: 122 MTKAVQRTMLKQRHGSIINMSSVVGVKGNAGQTNYAASKAGVIGFTKSVALELGSRNIRC 181 Query: 185 NAILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASP 244 NAI PG +E E ++ +G D +KG + + I L+R T DVA ++LAS Sbjct: 182 NAIAPGFIETEMTEK----------LGADVIKG-WTENIPLKRGGTPEDVANACVYLASD 230 Query: 245 AGQNISGQAISVDGNV 260 ++GQ ++VDG + Sbjct: 231 LSAYVTGQTLNVDGGM 246 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 248 Length adjustment: 24 Effective length of query: 239 Effective length of database: 224 Effective search space: 53536 Effective search space used: 53536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory